DVCEAAGKAIYIVSDGTGWTAEHSVNAALGQFENCLADRGCAVNTHLFSLIDDMDRLIEVIKQAAKEGALVLYTLADPSM
AEATKKACDFWGVPCTDVLRPTVEAIASHIGVAPSGIPRSSPSRNGRLSEDYFQRIDAIDFTIKQDDGALPQNLYRADIV
LAGVSRTGKTPLSIYLAQKGYKVANVPIVMGVDLPKSLFEINQDKVFGLTINPAIEMDHVRQELVHANQIFAQNPSWPVI
AVTGKAIEETAAVILGILHDRKQKCSMPRISKRY
The query sequence (length=274) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5d0n:A | 274 | 274 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 5d1f:A |
2 | 2oas:A | 427 | 100 | 0.1131 | 0.0726 | 0.3100 | 2.7 | 2oas:B |
3 | 3kta:B | 171 | 46 | 0.0584 | 0.0936 | 0.3478 | 2.8 | |
4 | 5msr:B | 520 | 169 | 0.1606 | 0.0846 | 0.2604 | 4.1 | 5msp:A, 5msr:A, 5msr:C, 5msr:D, 5msv:A, 5msv:B, 5msv:C, 5msv:D |
5 | 6o8m:A | 95 | 51 | 0.0584 | 0.1684 | 0.3137 | 4.2 | |
6 | 4xcq:A | 303 | 38 | 0.0547 | 0.0495 | 0.3947 | 5.8 | |
7 | 3f11:A | 316 | 68 | 0.0766 | 0.0665 | 0.3088 | 6.0 | 2pt2:A |
8 | 3wnb:A | 361 | 33 | 0.0365 | 0.0277 | 0.3030 | 6.5 | 3wnc:A |
9 | 2cxx:A | 184 | 96 | 0.1022 | 0.1522 | 0.2917 | 7.5 | 2cxx:B, 2cxx:C |
10 | 6kwt:A | 338 | 61 | 0.0657 | 0.0533 | 0.2951 | 9.5 | |
11 | 1dnp:A | 469 | 47 | 0.0511 | 0.0299 | 0.2979 | 9.7 | 1dnp:B |