DTYYLQVRGRENFEILMKLKESLELMELVPQPLVDSYRQQQ
The query sequence (length=41) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2wtt:L | 46 | 41 | 1.0000 | 0.8913 | 1.0000 | 5.00e-24 | 2wqj:K, 2wqj:Z, 2wtt:N, 2wtt:O, 2wtt:P |
2 | 2wqj:C | 32 | 28 | 0.6829 | 0.8750 | 1.0000 | 7.23e-14 | |
3 | 4d1l:F | 38 | 35 | 0.4634 | 0.5000 | 0.5429 | 3.82e-07 | 4cz5:C, 4cz6:D |
4 | 7bwn:J | 280 | 25 | 0.2927 | 0.0429 | 0.4800 | 0.12 | 7bwn:O, 7bwn:C, 7bwn:M, 4gf6:B, 4w74:A, 4w74:B, 4w74:H, 4w74:C, 4w74:D, 4w74:E, 4w76:A, 4w76:B, 4w77:A, 4w77:B, 4w7a:A, 4w7a:B, 4w7c:B, 4w7d:A, 4w7f:A, 4w7r:A, 4w7r:B, 4w7r:C, 4w7r:D |
5 | 4mzr:A | 234 | 25 | 0.2927 | 0.0513 | 0.4800 | 0.18 | 4mzr:B, 4mzr:C, 4mzr:D, 3q01:A, 3q01:B, 3q05:A, 3q05:C, 3q05:B, 3q05:D, 3q06:A, 3q06:C, 3q06:D, 3q06:B, 3ts8:A, 3ts8:B, 3ts8:C, 3ts8:D |
6 | 8ka5:A | 297 | 35 | 0.3171 | 0.0438 | 0.3714 | 1.2 | 8ka3:A, 8ka4:B, 8ka4:C |
7 | 8cbj:l | 286 | 34 | 0.2195 | 0.0315 | 0.2647 | 3.0 | 6eml:r, 6fai:l, 6rbd:l, 6y7c:l |
8 | 1m1j:B | 402 | 32 | 0.2927 | 0.0299 | 0.3750 | 3.1 | 1m1j:E |
9 | 1ml4:A | 307 | 34 | 0.3415 | 0.0456 | 0.4118 | 8.0 |