BioLiP

>protein
DTVKIDANVNYQIIQGFGGMSGVGWINDLTTEQINTAYGSGVGQIGLSIMRVRIDPDSSKWNIQLPSARQAVSLGAKIMA
TPWSPPAYMKSNNSLINGGRLLPANYSAYTSHLLDFSKYMQTNGAPLYAISIQNEPDWKPDYESCEWSGDEFKSYLKSQG
SKFGSLKVIVAESLGFNPALTDPVLKDSDASKYVSIIGGHLYGTTPKPYPLAQNAGKQLWMTEHYVDSKQSANNWTSAIE
VGTELNASMVSNYSAYVWWYIRRSYGLLTEDGKVSKRGYVMSQYARFVRPGALRIQATENPQSNVHLTAYKNTDGKMVIV
AVNTNDSDQMLSLNISNANVTKFEKYSTSASLNVEYGGSSQVDSSGKATVWLNPLSVTTFVSK

The query sequence (length=383) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2y24:A	383	383	1.0000	1.0000	1.0000	0.0
2	4uqa:A	391	389	0.4204	0.4118	0.4139	3.11e-101	5a6l:A, 5a6m:A, 4ckq:A, 4uqc:A
3	3kl0:A	397	389	0.4099	0.3955	0.4036	5.70e-92	3kl3:A, 3kl3:B, 3kl5:A, 3kl5:B, 3kl5:C
4	4qaw:A	537	390	0.4125	0.2942	0.4051	7.71e-92	4qaw:B, 4qaw:C, 4qaw:D, 4qaw:E, 4qaw:F, 4qaw:G, 4qaw:H, 4qb1:A, 4qb2:A, 4qb6:A
5	7n6o:A	433	431	0.3551	0.3141	0.3155	3.29e-48	7n6o:B
6	6m5z:A	433	396	0.2820	0.2494	0.2727	6.02e-27	6m5z:B
7	6krn:A	456	359	0.2324	0.1952	0.2479	1.45e-18
8	8idp:A	446	354	0.2324	0.1996	0.2514	1.95e-13	8idp:C, 8idp:B, 8idp:D, 8idq:A, 8idq:B, 8idq:C, 8idq:D
9	2wnw:B	445	285	0.1802	0.1551	0.2421	4.20e-13	2wnw:A
10	8cbc:A	455	457	0.2898	0.2440	0.2429	6.07e-13	8c48:A, 8c48:B, 8cbc:B, 7o0e:A, 7o0e:G, 8p67:A, 8p67:B
11	5ngl:B	454	314	0.1932	0.1630	0.2357	3.88e-10	5ngl:A, 5ngl:C
12	9fa6:A	501	430	0.2193	0.1677	0.1953	1.68e-05	8awk:AAA, 8awr:AAA, 8ax3:A, 8ax3:B, 9f9z:A, 9fa3:A, 9fad:A, 9fal:A, 9fay:A, 9faz:A, 9fb2:A, 9fdi:A, 3gxf:B, 3gxf:D, 5lvx:C, 5lvx:B, 5lvx:A, 5lvx:D, 6moz:A, 2nsx:A, 2nsx:B, 2nsx:C, 2nsx:D, 2nt0:A, 2nt0:B, 2nt0:C, 2nt0:D, 7nwv:AAA, 7nwv:BBB, 8p3e:B, 8p41:A, 8p41:B, 6q1n:A, 6q1n:B, 6q1p:A, 6q1p:B, 6q6k:A, 6q6k:B, 6q6l:A, 6q6l:B, 6q6n:A, 6q6n:B, 3rik:B, 3rik:D, 3ril:A, 3ril:B, 3ril:C, 3ril:D, 6t13:B, 6t13:C, 6t13:A, 6t13:D, 6tjq:BBB, 6tn1:AAA, 2v3d:A, 2v3d:B, 2v3e:A, 2v3e:B, 2vt0:A, 2vt0:B, 2wcg:A, 2wcg:B, 2xwd:A, 2xwd:B, 2xwe:A, 2xwe:B, 1y7v:A, 1y7v:B, 6ytp:AAA, 6ytp:BBB, 6ytr:AAA, 6ytr:BBB, 6yut:AAA, 6yut:BBB, 6yv3:AAA, 6yv3:BBB, 6z39:AAA, 6z39:BBB, 6z3i:BBB
13	3gwl:A	106	38	0.0392	0.1415	0.3947	3.3	3gwl:B
14	8xc1:A	660	111	0.0757	0.0439	0.2613	4.0	8hip:B, 8hip:A, 8hke:A, 8hke:B, 8xbs:A, 8xbs:B, 8xc1:B
15	3q1e:D	116	38	0.0392	0.1293	0.3947	4.2	3q1e:A, 3q1e:C, 3q1e:B
16	5u89:A	1039	79	0.0548	0.0202	0.2658	7.2
17	5gsm:A	786	21	0.0261	0.0127	0.4762	8.6	5gsm:B
18	8crx:J	134	27	0.0313	0.0896	0.4444	9.4	8cvo:J

[Back]