DTDTADQVMASFKILAGDKNYITMDELRRELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESDL
The query sequence (length=71) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2n8y:A | 153 | 71 | 1.0000 | 0.4641 | 1.0000 | 6.91e-48 | 6c0a:A |
2 | 1h8b:A | 73 | 71 | 0.7606 | 0.7397 | 0.7606 | 1.07e-35 | 7b56:A, 6ts3:A, 6ts3:B |
3 | 2kn2:A | 92 | 29 | 0.1690 | 0.1304 | 0.4138 | 1.4 | |
4 | 4hrg:A | 114 | 29 | 0.1690 | 0.1053 | 0.4138 | 1.7 | 1bt6:A, 1bt6:B, 4drw:A, 4drw:B, 4drw:C, 4drw:D, 4ftg:A, 4ftg:B, 4hre:E, 4hre:F, 4hre:I, 4hre:J, 4hrg:B, 4hrh:A, 4hrh:B |
5 | 2l1w:A | 149 | 30 | 0.1690 | 0.0805 | 0.4000 | 2.2 | 2ksz:A, 2roa:A, 2rob:A |
6 | 5x7o:A | 1247 | 38 | 0.1972 | 0.0112 | 0.3684 | 2.6 | 5x7o:B, 5x7p:B, 5x7p:A, 5x7q:A, 5x7q:B, 5x7r:A, 5x7r:B, 5x7s:A, 5x7s:B |
7 | 5esz:A | 212 | 50 | 0.2535 | 0.0849 | 0.3600 | 3.1 | |
8 | 5mkf:A | 481 | 26 | 0.1268 | 0.0187 | 0.3462 | 7.1 | 8hk7:A, 8hk7:B, 8hk7:C, 8hk7:D, 5mke:A, 5mke:B, 5mke:C, 5mke:D, 5mkf:B, 5mkf:C, 5mkf:D, 6t9n:A, 6t9n:B, 6t9n:C, 6t9n:D, 6t9o:A, 6t9o:B, 6t9o:C, 6t9o:D |
9 | 8t7c:A | 1001 | 59 | 0.1972 | 0.0140 | 0.2373 | 8.2 | |
10 | 1h7q:A | 240 | 18 | 0.1408 | 0.0417 | 0.5556 | 8.6 | 1h7l:A, 1qgq:A, 1qgs:A |