DSRELIARYQILLAELAAIRADIAAERTGDPYVRKLARELKRLAQEAAEEVKRDPSSSDVNMALLLILLMIELAVRALEA
AERTGDPEVRELAAELVWLAVEAAEEVQRNPSSSDVWLALHLIMLAIWAAVAALEAAERTGDPEVRELARELVRLAVEAA
EEVQRNPSSKEVYMALLLILIAILEAVLSLLRAERSGDPEKREKARERVREAVERAEE
The query sequence (length=218) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7unj:A | 218 | 218 | 1.0000 | 1.0000 | 1.0000 | 5.59e-144 | 7unj:B |
2 | 6n4n:F | 191 | 157 | 0.5963 | 0.6806 | 0.8280 | 5.67e-78 | 6n4n:C |
3 | 6n4n:F | 191 | 136 | 0.4633 | 0.5288 | 0.7426 | 1.81e-51 | 6n4n:C |
4 | 6n4n:F | 191 | 114 | 0.3853 | 0.4398 | 0.7368 | 1.37e-42 | 6n4n:C |
5 | 6n4n:F | 191 | 66 | 0.1927 | 0.2199 | 0.6364 | 3.07e-14 | 6n4n:C |
6 | 8fit:A | 229 | 206 | 0.3165 | 0.3013 | 0.3350 | 7.79e-07 | 8fit:C |
7 | 8fit:A | 229 | 68 | 0.1193 | 0.1135 | 0.3824 | 0.008 | 8fit:C |
8 | 8fit:A | 229 | 68 | 0.1101 | 0.1048 | 0.3529 | 0.011 | 8fit:C |
9 | 7tcd:A | 436 | 82 | 0.1422 | 0.0711 | 0.3780 | 1.19e-04 | 4wf0:A, 4wf0:B |
10 | 7ue2:A | 304 | 157 | 0.2294 | 0.1645 | 0.3185 | 0.016 | |
11 | 7ue2:A | 304 | 148 | 0.1835 | 0.1316 | 0.2703 | 0.34 | |
12 | 5kyn:A | 730 | 47 | 0.0963 | 0.0288 | 0.4468 | 0.19 | 3efo:A, 3eg9:A, 3egd:A, 3egx:A, 8hr0:A, 5kyn:B, 5kyu:A, 5kyw:A, 5kyx:A, 5kyy:A, 2nup:A, 2nut:A, 5vne:A, 5vnf:A, 5vng:A, 5vnh:A, 5vni:A, 5vnj:A, 5vnk:A, 5vnl:A, 5vnm:A, 5vnn:A, 5vno:A |
13 | 7udj:H | 192 | 136 | 0.1927 | 0.2188 | 0.3088 | 0.31 | |
14 | 2y6o:A | 263 | 69 | 0.0963 | 0.0798 | 0.3043 | 1.2 | 2xyu:A |
15 | 3dak:D | 284 | 141 | 0.1514 | 0.1162 | 0.2340 | 2.4 | 3dak:A, 3dak:B, 3dak:C, 2vwi:B, 2vwi:C, 2vwi:D |
16 | 7udm:B | 281 | 163 | 0.1972 | 0.1530 | 0.2638 | 2.9 | 7udl:A, 7udm:A |
17 | 3ndb:B | 420 | 82 | 0.1147 | 0.0595 | 0.3049 | 3.7 | 2v3c:C, 2v3c:D, 4xco:D |
18 | 8gdl:A | 355 | 37 | 0.0550 | 0.0338 | 0.3243 | 3.8 | 8gdl:B |
19 | 4i5j:A | 266 | 31 | 0.0550 | 0.0451 | 0.3871 | 4.3 | 4i5k:A, 4i5k:B |
20 | 7zu8:A | 336 | 30 | 0.0459 | 0.0298 | 0.3333 | 4.3 | 7zva:A, 7zvb:A, 7zvc:A |
21 | 2w2l:A | 346 | 36 | 0.0826 | 0.0520 | 0.5000 | 6.8 | 2w2l:B, 2w2l:C, 2w2l:D |
22 | 3ozz:B | 82 | 74 | 0.0780 | 0.2073 | 0.2297 | 8.9 |