DSPLDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEAREHLYLVLFFDNKRTWQWLPR
TKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRSKVQG
The query sequence (length=125) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3mo8:A | 127 | 125 | 1.0000 | 0.9843 | 1.0000 | 2.50e-91 | 5c6s:A, 2x4w:A, 2x4x:A, 2x4x:C, 2x4x:E, 2x4x:G, 2x4y:A, 2x4y:C, 2x4y:E, 2x4y:G, 2x4y:I, 2x4y:K, 2x4y:M, 2x4y:O |
2 | 4z02:A | 119 | 118 | 0.6080 | 0.6387 | 0.6441 | 1.30e-55 | 7lh9:B |
3 | 7lh9:C | 107 | 119 | 0.5600 | 0.6542 | 0.5882 | 1.10e-48 | 4z02:B |
4 | 5ciu:B | 121 | 21 | 0.0720 | 0.0744 | 0.4286 | 0.50 | |
5 | 5nrr:B | 137 | 21 | 0.0720 | 0.0657 | 0.4286 | 0.74 | 5ciu:A, 5nr3:A, 5nr3:B, 5nrr:A, 5nrs:A, 5nrs:B, 5nrv:D, 5nrv:A, 5nv0:A, 5nv0:B, 5nv2:A, 5nv2:B, 5nv7:A, 5nv7:B, 6r3e:A |
6 | 3qj6:A | 90 | 19 | 0.0960 | 0.1333 | 0.6316 | 0.98 | 3qby:B |
7 | 9exy:B | 135 | 21 | 0.0880 | 0.0815 | 0.5238 | 0.98 | 6ue6:C, 6ue6:F |
8 | 9exw:A | 148 | 21 | 0.0880 | 0.0743 | 0.5238 | 1.0 | 9exw:B, 9exx:A, 9exx:B, 9exy:A, 7lmt:A, 7lmt:H, 7lmt:B, 7lmt:C, 7lmt:D, 7lmt:E, 7lmt:F, 7lmt:G, 7mdn:A, 7mdn:H, 7mdn:B, 7mdn:C, 7mdn:D, 7mdn:E, 7mdn:F, 7mdn:G, 6ue6:A, 6ue6:B, 6ue6:D, 6ue6:E, 6ue6:G, 6ue6:H, 5vc8:A, 7vln:B, 6xcg:A, 6xcg:B, 6xcg:C |
9 | 6iit:B | 100 | 19 | 0.0960 | 0.1200 | 0.6316 | 1.1 | 6iiq:A, 6iiq:B, 6iir:A, 6iir:B, 6iis:B, 6iis:A, 6iit:A |
10 | 1q20:A | 294 | 54 | 0.1440 | 0.0612 | 0.3333 | 1.2 | 1q1q:A, 1q1z:A, 1q22:A |
11 | 6kcp:B | 84 | 17 | 0.0880 | 0.1310 | 0.6471 | 1.4 | 6kco:O, 6kco:F, 6kco:M, 6kco:E, 6kco:P, 6kco:B, 6kco:H, 6kco:D, 6kco:I, 6kco:N, 6kco:G, 6kco:J, 6kco:L, 6kco:A, 6kco:C, 6kco:K |
12 | 5xsk:A | 90 | 17 | 0.0880 | 0.1222 | 0.6471 | 1.6 | |
13 | 8cbn:L | 86 | 17 | 0.0720 | 0.1047 | 0.5294 | 3.5 | 8cbn:K, 8cbq:K, 8pc5:K, 8pc6:L, 8pc6:K, 8peo:K, 8pep:L, 8pep:K, 6s01:K |
14 | 1sdd:B | 601 | 69 | 0.1520 | 0.0316 | 0.2754 | 4.2 | |
15 | 4g23:A | 476 | 29 | 0.0720 | 0.0189 | 0.3103 | 4.4 | 6bv5:A, 6bv6:A, 6bv8:A, 6bv9:A, 4g24:A, 4g25:A, 4g26:A, 6lvr:C, 6lvr:A |
16 | 6g2b:A | 123 | 71 | 0.1920 | 0.1951 | 0.3380 | 4.9 | 6g24:A, 6g25:A, 6g27:A, 6g29:A, 6g2c:A, 6g2e:A, 6g2f:A, 6g2o:A |
17 | 2zze:A | 744 | 32 | 0.0880 | 0.0148 | 0.3438 | 5.4 | 2zze:B, 2zzf:A, 2zzg:A, 2zzg:B |
18 | 3m0f:A | 203 | 47 | 0.1200 | 0.0739 | 0.3191 | 7.3 | 3m0f:B |
19 | 3vw4:A | 122 | 42 | 0.0800 | 0.0820 | 0.2381 | 8.6 | 3vw4:B |