BioLiP

>protein
DSLINLKIQKENPKVVNEINIEDLSLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKE

The query sequence (length=67) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3fnv:B	68	67	1.0000	0.9853	1.0000	1.49e-45	3fnv:A, 4oo7:A, 4oo7:B, 4ooa:A, 4ooa:B, 4ooa:C, 4ooa:D, 4ooa:E, 4ooa:F, 7p0p:A, 7p0p:B, 7p0p:C, 7p0p:D
2	3ew0:A	77	66	0.6866	0.5974	0.6970	1.15e-30	6de9:A, 3ew0:B, 4ezf:A, 4ezf:B, 4f1e:A, 4f1e:B, 4f1e:C, 4f1e:D, 4f1e:E, 4f1e:F, 4f1e:G, 4f1e:H, 4f1e:I, 4f1e:J, 4f1e:K, 4f1e:L, 4f1e:M, 4f1e:N, 4f1e:O, 4f1e:P, 4f1e:Q, 4f1e:R, 4f28:A, 4f28:B, 4f2c:A, 4f2c:B, 3lpq:A, 3lpq:B, 7p0o:A, 7p0o:B, 2qd0:A, 2qd0:B, 2qh7:A, 2qh7:B, 2r13:A, 3ree:A
3	7yvz:A	63	60	0.5224	0.5556	0.5833	1.89e-21
4	3s2r:B	78	63	0.5373	0.4615	0.5714	1.00e-20	3s2q:A, 3s2q:B, 3s2r:A
5	3tbo:A	54	18	0.1493	0.1852	0.5556	0.19
6	3tbn:A	87	17	0.1642	0.1264	0.6471	0.23
7	3tbn:A	87	19	0.1493	0.1149	0.5263	4.4
8	3tbm:A	61	22	0.1642	0.1803	0.5000	0.38	3tbm:B
9	4ntc:A	325	44	0.1940	0.0400	0.2955	1.1	4ntc:B
10	6avj:A	92	51	0.2687	0.1957	0.3529	1.2	6avj:B, 6avj:C
11	8iu2:R	298	19	0.1493	0.0336	0.5263	1.2
12	4jn6:C	339	19	0.1343	0.0265	0.4737	1.4	4jn6:A
13	8bn0:A	342	32	0.2090	0.0409	0.4375	7.7	8bai:A, 8bai:B, 8bai:C, 8bai:D, 8baz:A, 8baz:B, 8bb0:A, 8bb0:B, 8bmy:A, 8bmy:B, 8bmz:A, 8bmz:B
14	2jks:A	284	31	0.1642	0.0387	0.3548	8.4
15	6z1p:AV	129	37	0.2090	0.1085	0.3784	9.8

[Back]