BioLiP

>protein
DSLINLKIQKENPKVVNEINIEDLSLTKAAYCRCWRSKTFPACDGSCNKHNELTGDNVGPLILKKK

The query sequence (length=66) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3fnv:B	68	66	0.9848	0.9559	0.9848	3.71e-43	3fnv:A, 4oo7:A, 4oo7:B, 4ooa:A, 4ooa:B, 4ooa:C, 4ooa:D, 4ooa:E, 4ooa:F, 7p0p:A, 7p0p:B, 7p0p:C, 7p0p:D
2	3ew0:A	77	65	0.6667	0.5714	0.6769	1.56e-28	6de9:A, 3ew0:B, 4ezf:A, 4ezf:B, 4f1e:A, 4f1e:B, 4f1e:C, 4f1e:D, 4f1e:E, 4f1e:F, 4f1e:G, 4f1e:H, 4f1e:I, 4f1e:J, 4f1e:K, 4f1e:L, 4f1e:M, 4f1e:N, 4f1e:O, 4f1e:P, 4f1e:Q, 4f1e:R, 4f28:A, 4f28:B, 4f2c:A, 4f2c:B, 3lpq:A, 3lpq:B, 7p0o:A, 7p0o:B, 2qd0:A, 2qd0:B, 2qh7:A, 2qh7:B, 2r13:A, 3ree:A
3	3s2r:B	78	63	0.5606	0.4744	0.5873	3.59e-22	3s2q:A, 3s2q:B, 3s2r:A
4	7yvz:A	63	60	0.5152	0.5397	0.5667	1.00e-19
5	6avj:A	92	31	0.1970	0.1413	0.4194	0.23	6avj:B, 6avj:C
6	8iu2:R	298	19	0.1515	0.0336	0.5263	0.75
7	4ntc:A	325	44	0.1970	0.0400	0.2955	3.6	4ntc:B
8	3tbn:A	87	16	0.1515	0.1149	0.6250	3.7
9	1mvm:A	549	28	0.1515	0.0182	0.3571	6.9	1z1c:A
10	3tbo:A	54	15	0.1212	0.1481	0.5333	7.0
11	8bn0:A	342	32	0.2121	0.0409	0.4375	7.4	8bai:A, 8bai:B, 8bai:C, 8bai:D, 8baz:A, 8baz:B, 8bb0:A, 8bb0:B, 8bmy:A, 8bmy:B, 8bmz:A, 8bmz:B
12	2jks:A	284	31	0.1667	0.0387	0.3548	8.8
13	3tbm:A	61	19	0.1515	0.1639	0.5263	9.7	3tbm:B

[Back]