DSIDDKKWSKLFPRIVSDPDRSSNFMTRAIYVAFSAVLRNRNILGQEYFTKNYITEKLKCMTLCFRNLRSNQIAQLLRNA
GDATKDGFLKEVSLVITNNEGDLEAIEVFSMKFIYFENGGVVARLSTDKNGQEDPHFAKLAQLVYEGGDSVRDQMVTIVR
SVQFLCTKVLEPLPEEFTANFRLEYTNDAPSNFRIDGFEDSSTFYTLPDDIQSATIGHLRPGCHAANMECWSMLMS
The query sequence (length=236) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4tzq:C | 237 | 236 | 1.0000 | 0.9958 | 1.0000 | 0.0 | 4tzo:A, 4tzo:C, 4tzo:E, 4tzo:G, 4tzq:A |
2 | 4tzm:A | 239 | 235 | 0.8136 | 0.8033 | 0.8170 | 7.90e-145 | 4tzl:A, 4tzl:B, 4tzm:B, 4tzn:A, 4tzn:B, 4tzs:A, 4tzs:B |
3 | 2nvo:A | 496 | 169 | 0.1864 | 0.0887 | 0.2604 | 0.45 | |
4 | 5vn4:A | 237 | 72 | 0.0847 | 0.0844 | 0.2778 | 4.1 | 5vn4:B |
5 | 8fgw:A | 1081 | 65 | 0.0720 | 0.0157 | 0.2615 | 6.4 | |
6 | 2ppl:A | 449 | 36 | 0.0678 | 0.0356 | 0.4444 | 6.4 | |
7 | 7cfc:C | 179 | 37 | 0.0551 | 0.0726 | 0.3514 | 8.6 | 7cfc:A, 7cfc:B, 7cfc:D, 7cfc:E |