DSCMSFQCKRGHICKADQQGKPHCVCQDPVTCPPTKPLDQVCGTDNQTYASSCHLFATKCRLEGTKKGHQLQLDYFGACK
SIPTCTDFEVIQFPLRMRDWLKNILMQLYEANSEVKKIYLDEKRLLAGDHPIDLLLRDFKKNYHMYVYPVHWQFSELDQH
PMDRVLTHSELAPLRASLVPMEHCITRFFEECDPNKDKHITLKEWGHCFGIKEEDIDENLL
The query sequence (length=221) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7kbu:A | 221 | 221 | 1.0000 | 1.0000 | 1.0000 | 1.20e-168 | 7kbu:B |
2 | 1bmo:A | 233 | 231 | 0.6199 | 0.5880 | 0.5931 | 1.96e-102 | 1bmo:B, 1nub:A, 1nub:B, 1sra:A, 2v53:A |
3 | 2p6a:C | 282 | 90 | 0.1222 | 0.0957 | 0.3000 | 7.77e-05 | 1lr7:A, 1lr8:A |
4 | 2p6a:C | 282 | 88 | 0.1267 | 0.0993 | 0.3182 | 0.001 | 1lr7:A, 1lr8:A |
5 | 2p6a:C | 282 | 82 | 0.1267 | 0.0993 | 0.3415 | 0.022 | 1lr7:A, 1lr8:A |
6 | 4r1f:A | 366 | 154 | 0.1584 | 0.0956 | 0.2273 | 1.6 | 1zxn:A |
7 | 2jul:A | 181 | 33 | 0.0543 | 0.0663 | 0.3636 | 2.5 | 2e6w:A |
8 | 7d6v:B | 239 | 32 | 0.0543 | 0.0502 | 0.3750 | 5.4 | 7d6x:B |
9 | 3dd4:A | 214 | 86 | 0.0995 | 0.1028 | 0.2558 | 6.0 | |
10 | 2xrc:B | 485 | 43 | 0.0679 | 0.0309 | 0.3488 | 7.1 | 5o32:D, 5o32:H, 2xrc:A, 2xrc:D |
11 | 2xrc:C | 454 | 43 | 0.0679 | 0.0330 | 0.3488 | 7.3 | |
12 | 8f5o:B | 1134 | 73 | 0.1086 | 0.0212 | 0.3288 | 7.8 | 8f5p:B |
13 | 2scp:A | 174 | 31 | 0.0498 | 0.0632 | 0.3548 | 8.3 | 2scp:B |
14 | 5ey5:B | 383 | 44 | 0.0633 | 0.0366 | 0.3182 | 9.5 | 5ey5:D |
15 | 4v12:A | 337 | 94 | 0.1086 | 0.0712 | 0.2553 | 9.7 |