DRYGVLAYHSVVDDTAAKEEKQYFPQTISANLLISHFNWLKDNGYNVVSWQQIIDAENGKSTLPEKAVVLSFDDGYATMY
NVIYPILKAYNYPAVFAPVSSWLDTPVNQLIPYANIKLPRNVFVTWDQVREMEQSGLVEIASHTDNLHHGVRANPAGSQL
PAVVAPEYKNNRYESKTEYKNRLVQDFSRSSKSIQRQIGKKPRIMVWPYGQFNDVAIDAAKQSGMTHHFALGQKIINKIG
DRYVGRLLIDTETGFSTIKNFL
The query sequence (length=262) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4u10:A | 264 | 262 | 1.0000 | 0.9924 | 1.0000 | 0.0 | 4u10:B |
2 | 4f9j:A | 599 | 233 | 0.3664 | 0.1603 | 0.4120 | 1.74e-56 | 4f9d:A, 4f9d:B, 4f9j:B, 4p7n:A, 4p7q:A, 4p7r:A, 3vus:A, 3vus:B |
3 | 4wcj:A | 233 | 251 | 0.2366 | 0.2661 | 0.2470 | 7.99e-18 | |
4 | 6dq3:A | 227 | 217 | 0.2023 | 0.2335 | 0.2442 | 3.49e-08 | 6dq3:B |
5 | 6go1:A | 318 | 187 | 0.1603 | 0.1321 | 0.2246 | 4.74e-06 | 6go1:B |
6 | 4hd5:A | 316 | 219 | 0.1870 | 0.1551 | 0.2237 | 0.004 | 4v33:A, 4v33:B |
7 | 6zu5:LT0 | 160 | 70 | 0.0916 | 0.1500 | 0.3429 | 0.20 | |
8 | 6u0p:C | 585 | 39 | 0.0573 | 0.0256 | 0.3846 | 1.00 | 6u0p:A, 6u0p:B, 6u0p:D, 6u0p:E, 6u0p:F, 6u0s:A, 6u0s:B, 6u0s:C, 6u0s:D, 6u0s:E, 6u0s:F |
9 | 2dpd:B | 117 | 55 | 0.0573 | 0.1282 | 0.2727 | 1.4 | 2dpd:A, 2dpu:A, 2efw:A, 2efw:B, 2efw:F, 2efw:G, 1f4k:A, 1f4k:B |
10 | 8he1:A | 225 | 33 | 0.0458 | 0.0533 | 0.3636 | 1.5 | 8he2:A, 8he4:A, 8hf9:A |
11 | 2onf:A | 140 | 53 | 0.0763 | 0.1429 | 0.3774 | 1.8 | 2onf:B |
12 | 5jp6:A | 339 | 50 | 0.0725 | 0.0560 | 0.3800 | 3.5 | |
13 | 5og1:A | 819 | 56 | 0.0611 | 0.0195 | 0.2857 | 4.1 | 5ofo:C, 5ofo:F, 5ofo:E, 5ofo:D, 5ofo:B, 5ofo:A, 5og1:E, 6rn2:A, 6rn2:B, 6rn2:C, 6rn2:D, 6rn2:F, 6rn2:E, 6rn3:A, 6rn3:B, 6rn3:C, 6rn3:D, 6rn3:E, 6rn4:B, 6rn4:C, 6rn4:D, 6rn4:E |
14 | 7ax7:A | 205 | 32 | 0.0458 | 0.0585 | 0.3750 | 4.6 | |
15 | 2gru:A | 367 | 61 | 0.0725 | 0.0518 | 0.3115 | 6.2 | 2d2x:A, 2d2x:B, 2gru:B |
16 | 6w4q:D | 755 | 155 | 0.1489 | 0.0517 | 0.2516 | 8.6 | 5w6p:A, 5w6p:B, 5w6p:C, 5w6p:D, 5w6p:E, 5w6p:F, 5w6s:A |
17 | 3a9g:A | 338 | 69 | 0.0840 | 0.0651 | 0.3188 | 9.8 | 3a9h:A |