DRVETLVFDGAKTEARAIASDIAGSVGELAAAARTMSGVLGRGHAGQSTDRAGAINLLKANLEQHGFAFGSWFAEEPKAY
DGKDVIDNTERGGNADGAFTPYWSKDRNGNIQLSTFKADYAAEWYGLAAKSGKGAITQPYLAEGTDVPTTMTSIAYPVMS
NGRMIGVSGVDISLAALADRLSAVKPFGSGRVYLLSQSGKWLAAPIPELLMKEYDGEGVESVKDALSTGTPRMIENLTYD
GNEPFDRVVYPFSLPDVNAQWLVLVDVPR
The query sequence (length=269) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6d8v:A | 269 | 269 | 1.0000 | 1.0000 | 1.0000 | 0.0 | |
2 | 6fu4:A | 297 | 148 | 0.1673 | 0.1515 | 0.3041 | 8.96e-13 | 6fu4:B, 6fu4:C, 6fu4:D |
3 | 6f9g:D | 262 | 238 | 0.2454 | 0.2519 | 0.2773 | 4.55e-12 | 6f9g:A, 6f9g:B, 6f9g:C, 6f9g:E |
4 | 6py3:B | 238 | 149 | 0.1784 | 0.2017 | 0.3221 | 3.16e-08 | 6pxy:A, 6py3:A, 6py4:A, 6py5:A, 6pyi:A, 6q0f:A, 6q0g:A |
5 | 5ave:A | 252 | 99 | 0.1301 | 0.1389 | 0.3535 | 4.52e-08 | 5avf:A, 5avf:B, 3c8c:A, 3c8c:B, 6iov:A, 6iov:B |
6 | 5lt9:B | 253 | 144 | 0.1450 | 0.1542 | 0.2708 | 3.87e-07 | 5lt9:A, 5lto:A, 5lto:B |
7 | 7prq:B | 316 | 233 | 0.1784 | 0.1519 | 0.2060 | 8.38e-07 | 7prq:A, 7prr:A, 7prr:B |
8 | 5ltv:D | 226 | 143 | 0.1413 | 0.1681 | 0.2657 | 1.81e-06 | 5ltv:A, 5ltv:B, 5ltv:E |
9 | 5ltx:A | 243 | 89 | 0.1115 | 0.1235 | 0.3371 | 3.51e-06 | 5ltx:B, 5t65:A, 5t65:B, 5t7m:A, 5t7m:B |
10 | 7k5n:A | 237 | 92 | 0.1227 | 0.1392 | 0.3587 | 6.62e-04 | |
11 | 6w3o:B | 252 | 97 | 0.1152 | 0.1230 | 0.3196 | 0.003 | 6w3o:A, 6w3p:A, 6w3p:B, 6w3r:A, 6w3r:B, 6w3s:A, 6w3s:B, 6w3t:A, 6w3t:B, 6w3v:A, 6w3v:B, 6w3x:A, 6w3x:B, 6w3y:A, 6w3y:B, 4xmr:A, 4xmr:B |
12 | 8bmv:B | 249 | 117 | 0.0929 | 0.1004 | 0.2137 | 0.56 | 8bmv:A |
13 | 3t07:A | 583 | 83 | 0.0892 | 0.0412 | 0.2892 | 2.5 | 3t07:B, 3t07:C, 3t07:D, 3t0t:A, 3t0t:B, 3t0t:C, 3t0t:D |
14 | 8jzd:A | 166 | 51 | 0.0669 | 0.1084 | 0.3529 | 4.2 | 8jzd:C |
15 | 3bs4:A | 245 | 39 | 0.0558 | 0.0612 | 0.3846 | 4.2 | |
16 | 6x7w:A | 222 | 114 | 0.1115 | 0.1351 | 0.2632 | 6.7 | 6x7w:H |
17 | 5ha5:D | 244 | 41 | 0.0632 | 0.0697 | 0.4146 | 7.3 | 5ha5:B, 5ha5:C |