Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
DRMLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVG
QFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQAS
TVVTYVYQLIGDDVKVERIEYKKP

The query sequence (length=184) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 8tta:C 188 183 0.9946 0.9734 1.0000 6.89e-137 8ese:Z, 8fud:A, 8fud:B, 5gtu:A, 5osi:A, 5osi:D, 5osi:G, 3psn:A, 3psn:B, 3pso:A, 3pso:B, 8r02:B, 8rks:A, 8rks:E, 8rks:G, 8rks:C, 8tta:A, 8ttd:A, 6xs5:A, 6xs7:A, 6xs9:A, 6xs9:B, 6xsa:A, 1z2w:A, 1z2w:B
2 5xch:A 180 180 0.5489 0.5611 0.5611 9.28e-74 5xch:B
3 6xs8:A 184 188 0.4565 0.4565 0.4468 1.87e-49
4 3ck2:A 174 81 0.1250 0.1322 0.2840 4.04e-04
5 1su1:A 184 124 0.1848 0.1848 0.2742 0.018 1su1:B, 1su1:C, 1su1:D
6 4inj:A 326 59 0.0978 0.0552 0.3051 0.27 4inj:B
7 1s3n:A 165 82 0.1141 0.1273 0.2561 0.62 1s3n:B
8 4uwq:A 548 39 0.0815 0.0274 0.3846 3.5 4uwq:D, 4uwq:G, 4uwq:J, 2wdc:A, 2wdd:A, 2wde:A, 2wdf:A
9 2qv7:A 303 107 0.1630 0.0990 0.2804 7.9

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218