DRLLALQLQKEVDKEQNRQKGSPDEYHLRA
The query sequence (length=30) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8txx:K | 30 | 30 | 1.0000 | 1.0000 | 1.0000 | 8.34e-16 | |
2 | 5je1:A | 244 | 19 | 0.2667 | 0.0328 | 0.4211 | 0.96 | 5jdy:A, 5jdy:B, 5jdz:A, 5jdz:B, 5je0:A, 5je0:B, 5je1:B, 5je2:A, 5je2:B, 5je3:A, 5je3:B, 5je4:A, 5je4:B, 5je5:A |
3 | 8wm6:F | 161 | 14 | 0.3000 | 0.0559 | 0.6429 | 1.5 | 8wmj:F, 8wmv:F, 8wmw:F |
4 | 1jwy:A | 1039 | 17 | 0.3667 | 0.0106 | 0.6471 | 5.7 | 4ae3:A, 2aka:A, 7b19:A, 7b1a:A, 3bz7:A, 3bz8:A, 3bz9:A, 1d0x:A, 1d0y:A, 1d0z:A, 1d1a:A, 1d1b:A, 1d1c:A, 1fmw:A, 2jhr:A, 2jj9:A, 1jx2:A, 1lvk:A, 3mjx:A, 3mkd:A, 1mma:A, 1mmd:A, 1mmg:A, 1mmn:A, 1mne:A, 3mnq:A, 3myh:X, 3myk:X, 3myl:X, 4pjk:A, 1vom:A, 1w9i:A, 1w9j:A, 1w9k:A, 1w9l:A, 2x9h:A, 2xel:A, 2xo8:A, 2y8i:X, 1yv3:A, 6z2s:A, 6z7t:A, 6z7t:B, 6z7u:A |