BioLiP

>protein
DRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSP

The query sequence (length=76) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6ogj:B	82	76	1.0000	0.9268	1.0000	1.81e-52	5bt2:A, 6c1y:A, 6c1y:B, 3c2i:A, 6ogj:A, 6ogk:A, 6yww:A
2	2moe:A	71	64	0.4605	0.4930	0.5469	1.11e-20	4lg7:A
3	3vxv:A	65	60	0.4605	0.5385	0.5833	2.18e-19	3vxx:A, 3vyb:A, 3vyq:A, 3vyq:D
4	7mwm:A	74	76	0.4605	0.4730	0.4605	2.79e-12	6c1a:A, 6c1a:B, 6c1a:E, 6c1a:F, 6c1t:A, 6c1t:D, 6c1u:A, 6c1u:B, 6c1u:E, 6c1u:F, 6c1v:A, 6c1v:B, 6c1v:E, 6c1v:F, 6c2f:A, 6c2f:D, 6c2f:G, 6c2f:J, 6c2f:M, 6c2f:P, 6cnp:A, 6cnp:B, 6cnq:A, 6cnq:B, 7mwk:A, 7mwk:B, 7mwm:B, 7ray:A
5	2ky8:A	70	62	0.4079	0.4429	0.5000	6.93e-12
6	6ccg:A	72	63	0.3684	0.3889	0.4444	1.67e-11	6cc8:A, 6cc8:B, 6ccg:B, 6ceu:A, 6ceu:B, 6cev:A, 6cev:B
7	1ig4:A	75	62	0.3553	0.3600	0.4355	8.91e-09	6d1t:A
8	7fef:A	48	46	0.2632	0.4167	0.4348	2.21e-05
9	2en7:A	44	19	0.1447	0.2500	0.5789	0.94
10	5tky:A	597	40	0.2105	0.0268	0.4000	1.1	5tky:B
11	5oyj:C	223	60	0.2500	0.0852	0.3167	2.2
12	8wwu:B	492	77	0.3158	0.0488	0.3117	2.6	8wwu:A, 8wwu:C, 8wwu:D, 8wwu:E, 8wwu:F, 8wwv:A, 8wwv:B, 8wwv:C, 8wwv:D, 8wwv:E, 8wwv:F, 8x6z:A, 8x6z:B, 8x6z:C, 8x6z:D, 8x6z:E, 8x6z:F
13	5oxt:A	327	42	0.1579	0.0367	0.2857	2.9	8av5:A, 6ekw:A, 6ekx:A, 6eky:A, 6ekz:A, 6el0:A, 6el4:A, 5oxt:B, 5oxt:C, 5oxu:A, 5oy1:A, 5oy2:A, 7pn4:A, 7pn5:A, 7pn6:A, 7pn7:A, 7pn8:A, 7pn9:A, 7pna:A, 2yor:B, 2yor:A, 2yp1:A, 2yp1:B, 2yp1:C, 2yp1:D
14	6mfu:A	216	35	0.1842	0.0648	0.4000	3.5	6mfu:B, 6mfu:C, 6mfu:D
15	7ekr:B	309	18	0.1184	0.0291	0.5000	3.9	7ekr:A
16	2qm1:B	325	20	0.1316	0.0308	0.5000	5.0	2qm1:A, 2qm1:C, 2qm1:D
17	5hgr:A	315	18	0.1184	0.0286	0.5000	5.2	5hgr:B
18	8uha:V	550	39	0.1579	0.0218	0.3077	6.8	8uhd:V
19	5x1y:B	454	27	0.1447	0.0242	0.4074	8.6	5x1y:A, 5x1y:C, 5x1y:D, 5x1y:E, 5x1y:F
20	5nhk:B	132	35	0.1579	0.0909	0.3429	9.6	5nbc:A, 5nbc:B, 5nbc:C, 5nbc:D, 5nhk:A, 5nhk:C, 5nhk:D
21	10mh:A	327	28	0.1579	0.0367	0.4286	9.9	2c7o:A, 2c7p:A, 2c7q:A, 2c7r:A, 5ciy:A, 3eeo:A, 1fjx:A, 1hmy:A, 2hmy:B, 2hr1:A, 2i9k:A, 1m0e:A, 1mht:A, 3mht:A, 4mht:A, 5mht:A, 6mht:A, 7mht:A, 8mht:A, 9mht:A, 1skm:A, 1svu:B, 2uyc:A, 2uyh:A, 2uz4:A, 2z6a:A, 2z6q:A, 2z6u:A, 2zcj:A

[Back]