DRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVEPLK
VYLQKYRE
The query sequence (length=88) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6r2v:B | 93 | 88 | 0.9432 | 0.8925 | 0.9432 | 2.93e-60 | 7cvo:B, 7cvq:B, 7cvq:G, 7cvq:L, 7cvq:Q |
2 | 7c9o:B | 85 | 84 | 0.8636 | 0.8941 | 0.9048 | 8.10e-54 | |
3 | 7aw7:B | 92 | 88 | 0.7614 | 0.7283 | 0.7614 | 6.62e-48 | 7aw9:B, 4g91:B, 4g92:B, 6y35:B, 6y36:B, 6y37:B, 6y39:B, 6y39:E, 6y39:H |
4 | 4awl:B | 92 | 88 | 0.7386 | 0.7065 | 0.7386 | 7.91e-47 | 7ah8:A, 7ah8:C, 6qmp:B, 6qmq:B, 6qms:B, 8qu2:B, 8qu3:B, 8qu4:B |
5 | 1jfi:B | 135 | 87 | 0.3409 | 0.2222 | 0.3448 | 3.79e-16 | |
6 | 4wzs:B | 113 | 74 | 0.2955 | 0.2301 | 0.3514 | 1.60e-09 | |
7 | 1a7w:A | 68 | 64 | 0.2500 | 0.3235 | 0.3438 | 6.61e-04 | 5t5k:A, 5t5k:B, 5t5k:C, 5t5k:D, 5t5k:E, 5t5k:F |
8 | 8epm:A | 991 | 47 | 0.1364 | 0.0121 | 0.2553 | 0.082 | |
9 | 7xlq:A | 1319 | 47 | 0.1364 | 0.0091 | 0.2553 | 0.082 | 8epl:A, 7yg5:A |
10 | 6qmq:C | 84 | 74 | 0.2500 | 0.2619 | 0.2973 | 0.10 | 7ah8:B, 7ah8:D, 4awl:C, 6qmp:C, 6qms:C, 8qu2:C, 8qu3:C, 8qu4:C |
11 | 7aw9:C | 118 | 73 | 0.2273 | 0.1695 | 0.2740 | 0.48 | 7aw7:C, 4g91:C, 4g92:C, 6y35:C, 6y36:C, 6y37:C, 6y39:C, 6y39:F, 6y39:I |
12 | 6en3:A | 934 | 68 | 0.2273 | 0.0214 | 0.2941 | 1.5 | 8a49:C, 4nuy:A, 4nuz:A |
13 | 4m54:A | 310 | 26 | 0.1250 | 0.0355 | 0.4231 | 2.8 | |
14 | 7vfs:A | 1266 | 47 | 0.1250 | 0.0087 | 0.2340 | 2.9 | 7vfu:A, 7vfv:A, 7vfw:A |
15 | 7mix:A | 1326 | 47 | 0.1250 | 0.0083 | 0.2340 | 3.0 | 7miy:A |
16 | 2x6b:A | 287 | 63 | 0.1705 | 0.0523 | 0.2381 | 4.8 | 7n9k:A, 7n9l:A, 6o9t:A, 6o9u:A, 6o9v:A, 6o9v:B, 2x6a:A, 2x6c:A |
17 | 6px9:B | 207 | 52 | 0.1591 | 0.0676 | 0.2692 | 4.9 | |
18 | 4mp6:A | 334 | 25 | 0.1250 | 0.0329 | 0.4400 | 6.0 | 4mp8:A, 4mpd:A |
19 | 8e59:A | 1230 | 52 | 0.1705 | 0.0122 | 0.2885 | 6.0 | 8e5a:A, 8e5b:A, 7uhf:A, 7uhg:A |
20 | 8x90:A | 1377 | 47 | 0.1250 | 0.0080 | 0.2340 | 6.6 | 8x91:A, 8x93:A |
21 | 1oij:C | 238 | 42 | 0.1136 | 0.0420 | 0.2381 | 7.2 | 1oii:C, 1oij:D |
22 | 1vz4:D | 259 | 42 | 0.1136 | 0.0386 | 0.2381 | 7.7 | 1oii:A, 1oii:B, 1oii:D, 1oij:A, 1oij:B, 1oik:A, 1oik:D, 1vz4:A |
23 | 5coc:A | 124 | 55 | 0.2045 | 0.1452 | 0.3273 | 8.2 | |
24 | 1qr0:A | 228 | 47 | 0.1477 | 0.0570 | 0.2766 | 9.6 | 4mrt:A |