DREKLLTESGVYGTFATFQMDHDWWDLPGESRVISVAEVKGLVEQWSGKILVESYLLRGLSDHADLMFRVHARTLSDTQQ
The query sequence (length=237) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
4m05:B |
240 |
237 |
1.0000 |
0.9875 |
1.0000 |
8.11e-179 |
4m05:A, 4m05:C, 4m05:D, 4m05:E, 4m06:A, 4m06:B, 4m06:C, 4m06:D, 4m06:E, 4m07:A, 4m07:B, 4m07:C, 4m07:D, 4m07:E, 4m08:A, 4m08:B, 4m08:C, 4m08:D, 4m08:E, 4m09:A, 4m09:B, 4m09:C, 4m09:D, 4m09:E, 3nn1:A, 3nn1:B, 3nn1:C, 3nn1:D, 3nn1:E, 3nn2:A, 3nn2:B, 3nn2:C, 3nn2:D, 3nn2:E, 3nn3:A, 3nn3:B, 3nn3:C, 3nn3:D, 3nn3:E, 3nn4:A, 3nn4:B, 3nn4:C, 3nn4:D, 3nn4:E |
2 |
3q08:A |
241 |
238 |
0.4177 |
0.4108 |
0.4160 |
5.92e-59 |
3q08:B, 3q08:C, 3q08:D, 3q08:E, 3q08:F, 3q08:G, 3q08:H, 3q08:I, 3q08:J, 3q08:K, 3q08:L, 3q08:M, 3q08:N, 3q08:O, 3q08:P, 3q08:Q, 3q08:R, 3q08:S, 3q08:T, 3q09:A, 3q09:B, 3q09:C, 3q09:D, 3q09:E, 3q09:F, 3q09:G, 3q09:H, 3q09:I, 3q09:J, 3q09:K, 3q09:L, 3q09:M, 3q09:N, 3q09:O, 3q09:P, 3q09:Q, 3q09:R, 3q09:S, 3q09:T, 2vxh:A, 2vxh:B, 2vxh:C, 2vxh:D, 2vxh:E, 2vxh:F |
3 |
5a13:B |
245 |
238 |
0.4135 |
0.4000 |
0.4118 |
1.68e-55 |
5a12:A, 5a12:B, 5a12:C, 5a12:D, 5a12:E, 5a13:A, 5a13:C, 5a13:D, 5a13:E, 5a13:F, 5a13:G, 5a13:H, 5a13:I, 5a13:J |
4 |
3qpi:A |
173 |
128 |
0.1646 |
0.2254 |
0.3047 |
3.78e-11 |
3qpi:B |
5 |
7ati:A |
182 |
89 |
0.1308 |
0.1703 |
0.3483 |
8.78e-09 |
7asb:A, 7asb:B, 7ati:B, 5k8z:A, 5k8z:B, 5k8z:C, 5k8z:D, 5k90:A, 5k90:B, 5k90:C, 5k90:D, 5k91:A, 5k91:B, 5k91:C, 5k91:D, 5mau:A, 5mau:B, 5nku:A, 5nku:B, 5nkv:A, 5nkv:B, 7ou5:A, 7ou5:B, 7ou7:A, 7ou7:B, 7ou9:A, 7ou9:B, 7oua:A, 7oua:B, 7ouy:A, 7ouy:B, 7ouy:C, 7ouy:D, 7owi:A, 7owi:B, 7owi:C, 7owi:D, 8quu:A, 8quu:B, 8quv:A, 8quv:B, 8quz:A, 8quz:B, 8qvb:A, 8qvb:B |
6 |
5t2k:B |
243 |
229 |
0.2405 |
0.2346 |
0.2489 |
1.23e-06 |
5t2k:A, 5t2k:C, 5t2k:D, 5t2k:E |
7 |
7q4g:C |
231 |
209 |
0.1983 |
0.2035 |
0.2249 |
0.002 |
7q4f:A, 7q4f:B, 7q4f:C, 7q4f:D, 7q4f:E, 7q4g:A, 7q4g:B, 7q4g:D, 7q4g:E, 6xub:A, 6xub:B, 6xub:C, 6xub:D, 6xub:E, 6xuc:A, 6xuc:B, 6xuc:C, 6xuc:D, 6xuc:E |
8 |
7pkt:c |
318 |
45 |
0.0717 |
0.0535 |
0.3778 |
0.60 |
|
9 |
6fxj:A |
251 |
60 |
0.0759 |
0.0717 |
0.3000 |
1.7 |
6fxj:B, 6fxj:C, 6fxj:D, 6fxj:E, 6fxq:A, 6fxq:B, 6fxq:C, 6fxq:D, 6fxq:E, 5loq:A, 5loq:B, 5loq:C, 5loq:D, 5loq:E |
10 |
2bov:A |
173 |
51 |
0.0717 |
0.0983 |
0.3333 |
1.9 |
2a78:A, 2a9k:A, 8fjh:B, 8fji:B, 6p0i:B, 6p0j:B, 6p0k:B, 6p0l:B, 6p0m:B, 6p0n:B, 6p0o:B, 1u8y:A, 1u8y:B, 1u8z:A, 1u8z:B, 1u90:A, 1u90:B, 1uad:A, 1uad:B, 1zc3:A, 1zc3:C, 1zc4:A, 1zc4:C |
11 |
4c1n:A |
442 |
64 |
0.0844 |
0.0452 |
0.3125 |
2.4 |
4c1n:C, 4c1n:E, 4c1n:G, 2h9a:A, 2ycl:A |
12 |
3k31:A |
262 |
55 |
0.0802 |
0.0725 |
0.3455 |
2.6 |
|
13 |
8wm7:D |
257 |
69 |
0.0802 |
0.0739 |
0.2754 |
4.8 |
8w9m:D |
14 |
7q2x:D |
994 |
143 |
0.1350 |
0.0322 |
0.2238 |
8.4 |
7q2y:D |
15 |
4s2r:P |
615 |
45 |
0.0717 |
0.0276 |
0.3778 |
9.7 |
4s2r:Q, 4s2t:P, 4s2t:Q |