DRAVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAV
LLKENDAFE
The query sequence (length=89) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 9b0z:A | 89 | 88 | 0.9888 | 0.9888 | 1.0000 | 8.18e-57 | 9b0b:A, 9b0b:B, 9b0b:C, 9b0b:D, 9b0z:B, 9b12:C, 9b12:D, 9b12:E, 9b12:F |
2 | 4owf:B | 86 | 80 | 0.3820 | 0.3953 | 0.4250 | 3.93e-11 | 9azj:A, 9azj:B, 4owf:A, 7tv4:B, 7tv4:D |
3 | 1iqc:A | 308 | 46 | 0.1573 | 0.0455 | 0.3043 | 2.0 | 1iqc:B, 1iqc:C, 1iqc:D |
4 | 7npa:A | 618 | 46 | 0.1573 | 0.0227 | 0.3043 | 4.9 | 7npa:B, 7npa:C, 7npa:D, 7npa:E, 7npa:F, 7npa:G, 7npa:H, 7npa:I, 7npa:J, 7npa:K, 7npa:L, 7npa:M, 7npa:N, 7npa:O, 7npa:P |