DQLAKLSYEKTLRNLATQTQNSSKQDKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEARKRQMQNAKTLYGVESF
INDKNKQFNEKLSRES
The query sequence (length=96) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 5gm6:f | 102 | 96 | 1.0000 | 0.9412 | 1.0000 | 3.45e-64 | 6bk8:R, 5gmk:I, 6j6g:I, 6j6h:I, 6j6n:I, 6j6q:I, 5wsg:I, 5y88:K, 5ylz:K |
| 2 | 7b9v:y | 134 | 96 | 0.8229 | 0.5896 | 0.8229 | 1.81e-44 | 6exn:y, 5mps:y, 5mq0:y |
| 3 | 8ouo:B | 625 | 61 | 0.1875 | 0.0288 | 0.2951 | 0.80 | 6nq0:A, 6nq0:B, 6nq2:A, 6nq2:B |
| 4 | 8ouo:A | 648 | 61 | 0.1875 | 0.0278 | 0.2951 | 0.81 | |
| 5 | 8i0u:R | 380 | 33 | 0.1458 | 0.0368 | 0.4242 | 5.9 | 8c6j:K, 8i0s:R, 8i0t:R, 8i0v:R, 8i0w:R, 6icz:R, 6id0:R, 6id1:R, 5mqf:C, 6qdv:K, 7w59:R, 7w5a:R, 7w5b:R, 5xjc:R, 5yzg:R, 6zym:C |
| 6 | 9fmd:R | 328 | 33 | 0.1458 | 0.0427 | 0.4242 | 7.1 | 8ro2:R |
umich.edu