BioLiP

>protein
DQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPELGV
TLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGG
DQGILNTFFSSWATTDIRKHLPFIYNLSSSAKVVHFLGRVKPWNYTPEFLILWWNIFTTNVLPL

The query sequence (length=224) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3t7m:A	263	258	1.0000	0.8517	0.8682	2.20e-160	6eql:A, 6eql:B, 1ll2:A, 3qvb:A, 3rmv:A, 3rmw:A, 3t7m:B, 3t7n:A, 3t7n:B, 3t7o:A, 3t7o:B, 3u2t:A, 3u2u:A, 3u2u:B, 3u2v:A, 3u2v:B, 3u2w:A, 3u2w:B, 3u2x:A, 3u2x:B, 1zct:A, 1zct:B
2	1zdf:A	258	252	0.9018	0.7829	0.8016	6.78e-148	3v8z:A, 3v91:A, 1zdg:A
3	4ueg:B	249	248	0.7143	0.6426	0.6452	9.65e-115	4ueg:A
4	6mw5:A	239	238	0.3571	0.3347	0.3361	4.12e-38	6mw8:A
5	5gvv:A	392	136	0.1562	0.0893	0.2574	0.030	5gvv:F, 5gvw:C, 5gvw:A, 5gvw:B, 5gvw:D
6	5h60:A	304	97	0.0893	0.0658	0.2062	0.037	7ym5:A
7	8snd:A	500	56	0.0714	0.0320	0.2857	0.99	8snc:A, 8sne:A, 7sp6:A, 7sp7:A, 7sp8:A, 7sp9:A, 7spa:A
8	1kjv:A	276	54	0.0848	0.0688	0.3519	1.2
9	6u4b:A	570	25	0.0491	0.0193	0.4400	6.3
10	3l4g:C	508	68	0.0848	0.0374	0.2794	8.5	3l4g:A, 3l4g:E, 3l4g:G, 3l4g:I, 3l4g:K, 3l4g:M, 3l4g:O
11	1kjm:A	277	27	0.0625	0.0505	0.5185	9.2	1ed3:A, 1ed3:D, 6nf7:A, 6nf7:D, 6nf7:G, 6nf7:J, 6nf7:M
12	6aci:A	304	37	0.0446	0.0329	0.2703	9.8

[Back]