BioLiP

>protein
DPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLA

The query sequence (length=41) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8i0r:v	173	41	1.0000	0.2370	1.0000	2.53e-26	7abg:F, 7abh:F, 6ff4:7, 6ff7:7, 8i0p:v, 8i0t:v, 7q4o:1, 7q4p:1, 8qo9:G, 6qx9:A2, 8qxd:8, 8r0a:8, 8r0b:8, 8rm5:8, 7vpx:B
2	8ch6:I	185	41	0.9268	0.2054	0.9268	2.15e-21	7abi:F, 7onb:M, 7qtt:I, 5z56:v, 5z57:v
3	5nrl:U	196	40	0.4634	0.0969	0.4750	1.47e-06
4	6g90:U	196	40	0.4634	0.0969	0.4750	1.66e-06	7oqb:U, 7oqe:U
5	7dco:v	207	40	0.4634	0.0918	0.4750	1.76e-06	5gm6:I, 5zwm:v, 5zwo:v
6	8qzs:r	114	35	0.3171	0.1140	0.3714	0.008	7abf:N, 7abg:N, 7abi:N, 8h6k:4N, 5o9z:N, 8q7n:r, 8qpe:r
7	1xed:A	111	39	0.2927	0.1081	0.3077	0.17	1xed:B
8	8idf:A	459	28	0.2683	0.0240	0.3929	0.26
9	8ost:A	390	30	0.2927	0.0308	0.4000	0.50
10	6iw6:A	438	30	0.2927	0.0274	0.4000	0.50	6iw6:B
11	8pv1:Cb	101	32	0.2927	0.1188	0.3750	0.62	8pv2:Cb, 8pv3:Cb, 8pv4:Cb, 8pv5:Cb, 8pv6:Cb, 8pv7:Cb, 8pv8:Cb, 8pvk:Cb, 8pvl:Cb
12	1zu1:A	127	24	0.2439	0.0787	0.4167	0.99
13	7mo3:B	38	31	0.2195	0.2368	0.2903	1.5	7mo3:D, 7mo4:B, 7mo4:D
14	6jmt:D	350	36	0.2195	0.0257	0.2500	1.9	6jmt:C, 6jmt:E, 6jmt:F, 6jmt:A, 6jmt:B
15	2ebv:A	57	31	0.2195	0.1579	0.2903	2.5
16	8opt:A	783	29	0.2195	0.0115	0.3103	9.1	8ops:A, 5w0m:B, 5w0n:C, 5w0o:A, 5w0o:B

[Back]