>protein
DPVHFYETSYKYQAADSTYMHDVAINVSIKGNHFTSDIIIRELVKSENKNYYNVIGHGDIIQKNTHQYYLNFDNIDVYTG
TNKANMKPYKEPTSISSLINKSNNIRVVYLSEEYVVVEFFFYDGQIITLHRY
The query sequence (length=132) is searched through a non-redundant set of database sequences
protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # |
Hit |
Hit
length |
Aligned
length |
Identity
(normalized by query) |
Identity
(normalized by hit) |
Identity (normalized
by aligned length) |
E-value |
Homologs
to hit |
| 1 |
8dml:B |
133 |
132 |
1.0000 |
0.9925 |
1.0000 |
2.53e-94 |
8dml:D, 8dml:F, 8dml:H, 5kew:B, 5kew:D, 5kew:F |
| 2 |
4qbz:A |
754 |
88 |
0.1742 |
0.0305 |
0.2614 |
0.42 |
5awa:A, 5awb:A, 5awc:A, 5awc:B, 5awc:C, 5awc:D, 5awd:A, 5az5:A, 5az5:B, 5az5:C, 5az5:D, 7crf:A, 7crf:B, 6kya:A, 6kya:B, 4qbz:B, 4qc0:A, 4qc0:B, 4r07:A, 4r07:B, 4r07:C, 4r07:D, 4r08:A, 4r08:B, 4r08:C, 4r08:D, 4r09:A, 4r09:B, 4r09:C, 4r09:D, 4r0a:A, 7r52:B, 7r53:A, 7r53:B, 7r54:A, 7r54:B, 4r6a:A, 4r6a:B, 7rc9:A, 7rc9:B, 6ty5:A, 6ty5:B, 6v9u:A, 6v9u:B, 3w3g:A, 3w3j:A, 3w3j:B, 3w3k:A, 3w3k:B, 3w3l:A, 3w3l:B, 3w3l:D, 3w3l:C, 3w3m:A, 3w3n:A, 3w3n:B, 6wml:A, 6wml:B, 6wml:C, 6wml:D, 3wn4:A, 5wyx:A, 5wyx:B, 5wyz:A, 5wyz:B, 7ytx:A, 7ytx:B, 5z14:A, 5z14:B, 5z15:A, 5z15:B, 6zjz:A, 6zjz:B |
| 3 |
3ne8:A |
226 |
45 |
0.1136 |
0.0664 |
0.3333 |
6.8 |
|
| 4 |
3fcp:A |
356 |
46 |
0.1061 |
0.0393 |
0.3043 |
7.5 |
3fcp:B, 3fcp:C, 3fcp:D, 3fcp:E, 3fcp:F, 3fcp:G, 3fcp:H |
[Back]
umich.edu