DPPLQFHSVHGDNIRISRDGTLARRFESFCRAITFSARPVRINERICVKFAEISNNWNGGIRFGFTSNDPVTLEGTLPKY
ACPDLTNRPGFWAKALHEQYCEKDNILYYYVNGAGDVIYGINNEEKGVILTGIDTRSLLWTVIDIYGNCTGIEFLDS
The query sequence (length=157) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4kg0:A | 157 | 157 | 1.0000 | 1.0000 | 1.0000 | 7.55e-117 | |
2 | 7xpt:A | 375 | 112 | 0.1720 | 0.0720 | 0.2411 | 1.1 | 8hl8:A, 8hl8:C, 7xpr:A, 7xpr:B, 7xps:A, 7xps:B, 7xpt:B, 7xpu:A, 7xpu:B, 7xpv:A, 7xpv:B, 7yua:A, 7yua:B, 7yua:C, 7yua:D |
3 | 7arc:F | 430 | 52 | 0.0955 | 0.0349 | 0.2885 | 3.5 | 7ard:F |
4 | 3lrl:A | 452 | 60 | 0.1019 | 0.0354 | 0.2667 | 3.8 | 3lrm:A, 3lrm:B, 3lrm:C, 3lrm:D |
5 | 3ht5:A | 335 | 54 | 0.1083 | 0.0507 | 0.3148 | 5.1 | 5u3f:A, 5u3f:B |
6 | 4rpu:A | 988 | 46 | 0.1083 | 0.0172 | 0.3696 | 5.4 | 4l3t:A, 4l3t:B, 4nge:A, 4nge:D, 4rpu:B |
7 | 4au9:A | 448 | 45 | 0.1083 | 0.0379 | 0.3778 | 9.1 | 5ag0:A, 5ag0:B, 5ag1:A, 5ag1:B, 4au9:B, 5ikd:A, 5ikg:A, 4uzi:A, 4uzi:B, 4w7j:A, 4w7j:B, 4w7j:C, 4w7j:D, 4w7k:A, 4w7k:B, 4w7l:A, 4w7l:B, 4w7m:A, 4w7m:B, 4w7n:A, 4w7n:B, 4w7o:A |