DPMALIDQLKEEQKLAMKAKDKLRLGTIRLALAAIKQREVDEQITLNDDDILAVLTKMVKQRRDSVTQYEAAGRQDLADV
EQAEITVLEEFMPQPLTEEEVAALIEKAIAESGAAGMQDMGKVMGVLKPQIQGRADMGKVSGLVRAKL
The query sequence (length=148) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8xjg:A | 148 | 148 | 1.0000 | 1.0000 | 1.0000 | 1.31e-101 | |
2 | 4fhc:A | 340 | 40 | 0.0811 | 0.0353 | 0.3000 | 0.30 | 4fhd:A, 4fhe:A, 4fhf:A, 4fhg:A, 4k9r:A, 4rh0:A, 4rh1:A |
3 | 2isj:A | 219 | 38 | 0.0946 | 0.0639 | 0.3684 | 1.1 | 2isj:B, 2isj:C, 2isj:D, 2isj:E, 2isj:F, 2isj:G, 2isj:H, 2isk:A, 2isk:B, 2isk:C, 2isk:D, 2isk:E, 2isk:F, 2isk:G, 2isk:H, 2isl:A, 2isl:B, 2isl:C, 2isl:D, 2isl:E, 2isl:F, 2isl:G, 2isl:H |
4 | 1j56:A | 124 | 57 | 0.1081 | 0.1290 | 0.2807 | 2.3 | 1krx:A |
5 | 1v26:B | 510 | 35 | 0.0946 | 0.0275 | 0.4000 | 5.2 | 1v25:A, 1v25:B, 1v26:A |
6 | 8tct:A | 275 | 48 | 0.1081 | 0.0582 | 0.3333 | 6.1 | |
7 | 2uzh:C | 155 | 34 | 0.1081 | 0.1032 | 0.4706 | 7.9 | 2uzh:A, 2uzh:B |
8 | 5x2n:C | 433 | 107 | 0.1689 | 0.0577 | 0.2336 | 9.5 | 5x2m:A, 5x2m:C, 5x2n:A, 5x2o:A, 5x2o:C, 5x2p:A, 5x2p:C, 5x2q:A, 5x2q:C |