DPITSTEEIPFDKKREFDPNMAPGTEKVVQKGEPGTKTITTPTTGEGEPTEKITKQPVDEIVHYGGEQIPQGHKDEFDPN
APVDSKTEVPGKPGVKNPDTGEVVTPPVDDVTKYGPVDGDSITSTEEIPFDKKREFDPNMAPGTEKVVQKGEPGTKTITT
PTTKNPMTGEKVGEGKSTEKVTKQPVDEIVEYGPT
The query sequence (length=195) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4fun:A | 206 | 203 | 0.9744 | 0.9223 | 0.9360 | 2.11e-126 | 4fum:A, 4fuo:A, 4fup:A, 4fup:B |
2 | 4fun:A | 206 | 77 | 0.3641 | 0.3447 | 0.9221 | 4.85e-41 | 4fum:A, 4fuo:A, 4fup:A, 4fup:B |
3 | 8deo:A | 454 | 202 | 0.8410 | 0.3612 | 0.8119 | 5.24e-98 | 8deo:B, 8g1l:A, 7sie:A |
4 | 8deo:A | 454 | 77 | 0.3179 | 0.1366 | 0.8052 | 2.50e-32 | 8deo:B, 8g1l:A, 7sie:A |
5 | 3tiq:B | 214 | 197 | 0.6051 | 0.5514 | 0.5990 | 3.63e-77 | 3tiq:A |
6 | 3tiq:B | 214 | 76 | 0.2103 | 0.1916 | 0.5395 | 5.31e-15 | 3tiq:A |
7 | 3a1n:A | 315 | 70 | 0.0974 | 0.0603 | 0.2714 | 0.38 | 3a1n:B, 3a4v:A, 3a4v:B, 3a9w:A, 3a9w:B, 3ajr:A, 3ajr:B |
8 | 4xev:A | 148 | 65 | 0.0872 | 0.1149 | 0.2615 | 2.1 | 3gm1:A, 3gm1:B, 4r32:A, 3u3f:A, 3u3f:B, 3u3f:C, 3u3f:D, 4xef:A, 4xef:D, 4xek:A, 4xev:D |
9 | 4r43:A | 601 | 21 | 0.0513 | 0.0166 | 0.4762 | 7.6 | 5i67:A, 4rcg:A, 4wie:A, 4wiu:A, 4wl8:A, 4wou:A, 4wpt:A, 4wpu:A, 4wpv:A |