BioLiP

>protein
DPAPVARALREELARTLYCEPGDIDDEASFNTLGLDSILGVEFVAFVNQTYGLDEKAGILYDHPSLAALSRHVAGRAA

The query sequence (length=78) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8ahq:C	78	78	1.0000	1.0000	1.0000	7.87e-53	8ahq:D
2	2liw:A	99	72	0.4103	0.3232	0.4444	4.74e-18
3	5hv8:A	95	59	0.2308	0.1895	0.3051	3.37e-06
4	7en2:B	1410	47	0.2308	0.0128	0.3830	4.15e-05	7emy:A, 7emy:B, 7en1:A, 7en1:B, 7en2:A
5	5zk4:D	73	54	0.2308	0.2466	0.3333	2.03e-04
6	8qzi:E	86	76	0.2692	0.2442	0.2763	0.003	7bdw:B, 6rcx:B
7	6d8i:A	79	65	0.1923	0.1899	0.2308	0.19
8	4af0:A	395	54	0.2308	0.0456	0.3333	0.46	4af0:B
9	8g3i:B	515	49	0.2051	0.0311	0.3265	0.98
10	8jqe:A	296	56	0.1923	0.0507	0.2679	1.9	8jqe:B
11	6sga:FJ	353	42	0.1923	0.0425	0.3571	2.2	6sg9:FJ, 6sgb:FJ
12	8w2d:A	322	44	0.1923	0.0466	0.3409	2.3	8w2d:B
13	7zmb:Q	85	36	0.1667	0.1529	0.3611	2.3	7zm7:O, 7zmb:O, 7zme:Q, 7zmg:O, 7zmg:Q
14	8bee:U	87	37	0.1667	0.1494	0.3514	2.6	7aqr:U, 7arb:U, 8bpx:U, 8bq5:U, 8bq6:U
15	5hkc:A	114	42	0.1667	0.1140	0.3095	2.8	5hk0:B, 5hk0:D, 5hk3:B
16	7ar7:T	84	36	0.1667	0.1548	0.3611	3.5	7ar8:T, 8bq6:T
17	3kpx:A	189	22	0.1667	0.0688	0.5909	4.4
18	8e73:AB	85	36	0.1667	0.1529	0.3611	4.6
19	5msr:B	520	57	0.1667	0.0250	0.2281	9.1	5msp:A, 5msr:A, 5msr:C, 5msr:D, 5msv:A, 5msv:B, 5msv:C, 5msv:D
20	8ba0:U	85	45	0.1923	0.1765	0.3333	9.3	8ba0:T, 8esz:AC

[Back]