DNWRDNLVRQVQHSELELVANFADIPLRLSQILKLKPGDVLPIEKPDRIIAHVDGVPVLTSQYGTVNGQYALRVEHLINP
ILNSLNEDIDLIMDIPVKLTVELGRTRMTIKELLRLTQGSVVALDGLAGEPLDILINGYLIAQGEVVVVADKYGVRITDI
ITPSERMRRLSR
The query sequence (length=172) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4yxb:B | 172 | 172 | 1.0000 | 1.0000 | 1.0000 | 5.08e-122 | 4yxb:A |
2 | 6seh:C | 252 | 86 | 0.1395 | 0.0952 | 0.2791 | 0.33 | 6seh:A |
3 | 6eg0:B | 309 | 90 | 0.1395 | 0.0777 | 0.2667 | 1.5 | 6nrw:B |
4 | 8fvz:A | 433 | 119 | 0.1512 | 0.0600 | 0.2185 | 2.3 | 8fvz:B, 7sp5:A, 7sp5:B |
5 | 6zck:A | 271 | 39 | 0.0640 | 0.0406 | 0.2821 | 4.3 | |
6 | 8w7g:A | 390 | 59 | 0.1105 | 0.0487 | 0.3220 | 4.6 | |
7 | 2z36:B | 404 | 62 | 0.1337 | 0.0569 | 0.3710 | 5.4 | 2z36:A |
8 | 8qhp:A | 410 | 49 | 0.0872 | 0.0366 | 0.3061 | 6.0 | 8qhp:B |
9 | 5vbu:A | 442 | 68 | 0.1279 | 0.0498 | 0.3235 | 7.0 | 5vbu:B, 5vbu:C, 4y8w:A, 4y8w:B, 4y8w:C |
10 | 8a1h:A | 516 | 39 | 0.0640 | 0.0213 | 0.2821 | 7.8 | 7ykn:A |
11 | 7o85:A | 332 | 46 | 0.0814 | 0.0422 | 0.3043 | 8.2 | 7o85:D, 7o85:G, 7o85:J, 7o85:M, 7o85:P, 7o85:S |
12 | 7kxr:A | 562 | 46 | 0.0814 | 0.0249 | 0.3043 | 8.2 | 3j9c:A, 7kxr:B, 7kxr:C, 7kxr:D, 7kxr:E, 7kxr:F, 7kxr:G, 6psn:A, 6psn:B, 6psn:C, 6psn:D, 6psn:E, 6psn:F, 6psn:G, 6uzb:A, 6uzb:B, 6uzb:C, 6uzb:D, 6uzb:E, 6uzb:F, 6uzb:G, 6uzd:A, 6uzd:B, 6uzd:C, 6uzd:D, 6uzd:E, 6uzd:F, 6uzd:G, 6uze:A, 6uze:B, 6uze:C, 6uze:D, 6uze:E, 6uze:F, 6uze:G |