DNNYSQGPVPISARKGGLALTFVMLGLTFFSASMWTGGALGTGLSFNDFFLAVLIGNLLLGIYTAFLGFIGSKTGLTTHL
LARYSFGIKGSWLPSFLLGGTQVGWFGVGVAMFAIPVGKATGIDINLLIAVSGILMTITVFFGISALTVLSIIAVPAIAI
LGSYSVYLAIHDMGGLSTLMNVKPTQPLDFNLALAMVVGSFISAGTLTADFVRFGRNPKVAVVVAIIAFFLGNTLMFVFG
AAGAASLGMADISDVMIAQGLLLPAIVVLGLNIWTTNDNALYASGLGFANITGLSSKKLSVINGIVGTVCALWLYNNFVG
WLTFLSAAIPPVGGVIIADYLMNKARYNTFNIATMQSVNWVALLAVAIGIVAGHWLPGIVPVNAVLGGAISYAVLNPILN
The query sequence (length=400) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7qoa:A | 401 | 400 | 1.0000 | 0.9975 | 1.0000 | 0.0 | 7qoa:B |
2 | 4d1a:A | 456 | 406 | 0.2350 | 0.2061 | 0.2315 | 5.29e-10 | 4d1b:A, 4d1c:A, 4d1d:A |
3 | 3nio:A | 316 | 97 | 0.0775 | 0.0981 | 0.3196 | 0.69 | 3nio:B, 3nio:C, 3nio:D, 3nio:E, 3nio:F |
4 | 8ofg:A | 151 | 97 | 0.0525 | 0.1391 | 0.2165 | 2.1 | 8ofg:B |