BioLiP

>protein
DMTWEGEYPPSKVLGPIMSKMPSGLLGLISIACAAVCAYSIAQSGVLQQQPGAYENGSWVKWYYVLGSFGGPLAWGTHVA
SWIQRKNGM

The query sequence (length=89) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6l4u:2u	89	89	1.0000	1.0000	1.0000	1.16e-61	6ly5:h
2	7y5e:RN	78	81	0.3708	0.4231	0.4074	6.39e-11	7y5e:R2, 7y7a:R7, 7y7a:Ro
3	8wm6:R	90	88	0.3371	0.3333	0.3409	8.81e-07	8wmj:R, 8wmv:R, 8wmw:R
4	8jw0:h	132	78	0.2584	0.1742	0.2949	5.28e-06
5	7y7b:R	92	25	0.1685	0.1630	0.6000	6.14e-05	7y8a:R
6	8jze:h	131	87	0.2921	0.1985	0.2989	9.51e-05	8jzf:h
7	8jjr:r	131	87	0.2809	0.1908	0.2874	7.33e-04
8	6co7:A	1061	54	0.2135	0.0179	0.3519	0.13	6co7:B, 6co7:C, 6co7:D
9	3c1t:B	326	37	0.1685	0.0460	0.4054	1.6	3bxx:A, 3bxx:B, 3bxx:C, 3bxx:D, 3bxx:E, 3bxx:F, 3c1t:A, 3c1t:C, 3c1t:D, 2c29:D, 2c29:F, 2iod:A, 2iod:B, 2iod:C, 2iod:D, 2nnl:D, 2nnl:F
10	6v3f:A	1234	76	0.3034	0.0219	0.3553	2.1	6v3h:A
11	6bcq:B	983	43	0.1685	0.0153	0.3488	3.0	6bco:B, 6bco:D, 6bco:A, 6bco:C, 6bcq:D, 6bcq:A, 6bcq:C
12	8wai:A	277	59	0.1910	0.0614	0.2881	5.3	8kce:A, 8wai:B
13	4v61:BE	266	41	0.1573	0.0526	0.3415	5.6	6eri:AC, 5h1s:E, 5mlc:D, 5mmi:C, 5mmm:C, 5x8p:C, 5x8t:C
14	8k1l:A	979	43	0.1461	0.0133	0.3023	6.7

[Back]