BioLiP

>protein
DLTDAELAADLAADAGKLLLQVRAEIGFDQPWTLGEAGDRQANSLLLRRLQAERPGDAVLSEEAHDDLARLKSDRVWIID
PLDGTREFSTPGRDDWAVHIALWRRPEITDAAVALPARGNVVYRTDTVTSGAAPAGVPGTLRIAVSATRPPAVLHRIRQT
LAIQPVSIGSAGAKAMAVIDGYVDAYLHAGGQWEWDSAAPAGVMLAAGMHASRLDGSPLRYNQLDPYLPDLLMCRAEVAP
ILLGAIADAWR

The query sequence (length=251) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5djj:A	257	251	1.0000	0.9767	1.0000	3.40e-179	5djg:A, 5djh:A, 5dji:A, 5djk:A
2	2wef:A	303	164	0.1833	0.1518	0.2805	3.55e-06	1jp4:A
3	2p3n:A	256	197	0.2032	0.1992	0.2589	4.64e-06	2p3n:B, 2p3n:C, 2p3n:D
4	5dw8:A	260	196	0.1912	0.1846	0.2449	8.24e-06	5dw8:B, 5j16:A, 5j16:B, 5j16:C, 5j16:D
5	6giu:A	275	240	0.2390	0.2182	0.2500	2.50e-05	4as4:A, 4as4:B, 1awb:A, 1awb:B, 6giu:B, 6gj0:A, 6gj0:B, 2hhm:A, 2hhm:B, 1ima:A, 1ima:B, 1imb:A, 1imb:B, 1imc:A, 1imc:B, 1imd:A, 1imd:B, 1ime:A, 1ime:B, 6zk0:AAA, 6zk0:BBB
6	4qxd:B	289	146	0.1474	0.1280	0.2534	1.26e-04	4qxd:A
7	3lv0:A	258	78	0.1036	0.1008	0.3333	1.61e-04	3luz:A, 3lv0:B
8	5zon:A	256	64	0.1076	0.1055	0.4219	1.76e-04	5yht:A, 5yht:B, 5zon:B, 5zon:C, 5zon:D
9	8wdq:A	273	198	0.2430	0.2234	0.3081	2.04e-04	8wdq:B
10	2bji:A	274	89	0.0996	0.0912	0.2809	8.04e-04	2bji:B
11	2czi:A	259	250	0.2510	0.2432	0.2520	0.003	2czh:B
12	5eq9:B	260	99	0.1155	0.1115	0.2929	0.003	5eq8:A, 5eq9:A, 5eq9:C, 5eq9:D, 5t3j:A
13	3luz:B	234	78	0.1036	0.1111	0.3333	0.003
14	4as5:A	274	210	0.1912	0.1752	0.2286	0.010	4as5:B, 4as5:C, 4as5:D
15	6ib8:B	270	87	0.0996	0.0926	0.2874	0.011	6ib7:A, 6ib8:A, 2qfl:A, 6tqn:T, 6tqn:S, 6tqo:T, 6tqo:S
16	8f9y:A	352	220	0.2112	0.1506	0.2409	0.018
17	5eyg:B	265	201	0.1514	0.1434	0.1891	0.051	5eyg:A, 5eyh:A, 5eyh:B, 5f24:A, 5f24:B, 4g61:A, 4g61:B, 4i3e:A, 4i3e:B, 4i3y:A, 4i3y:B, 4i40:A, 4i40:B, 4ptk:A, 4ptk:B, 3ryd:A, 3ryd:C
18	5q0c:A	328	50	0.0717	0.0549	0.3600	0.23	5et6:A, 5et6:C, 5et6:B, 5et6:D, 4he0:A, 4he1:A, 4he2:A, 3ifa:A, 3ifa:B, 3ifa:C, 3ifa:D, 3ifc:A, 3ifc:B, 3ifc:C, 3ifc:D, 5k56:A, 5l0a:A, 5q0c:B, 5q0c:C, 5q0c:D, 5q0c:E, 5q0c:F, 5q0c:G, 5q0c:H
19	5k55:A	290	49	0.0717	0.0621	0.3673	0.26	5et8:A
20	6c4m:C	418	84	0.1036	0.0622	0.3095	0.51
21	4hxv:A	317	176	0.1673	0.1325	0.2386	0.61	4o7i:A
22	1otw:A	255	41	0.0637	0.0627	0.3902	5.7	3hlx:A, 3hlx:D, 3hml:A, 3hml:B, 3hnh:A, 4ny7:A, 4ny7:B, 1otw:B
23	7l3o:B	401	120	0.1355	0.0848	0.2833	6.1	7l3o:A, 7l3o:C, 7l3o:D
24	1k9y:A	354	45	0.0677	0.0480	0.3778	6.8	1k9z:A, 1ka0:A, 1ka1:A, 1qgx:A
25	6sup:A	2128	86	0.0797	0.0094	0.2326	7.9
26	4o48:A	298	23	0.0518	0.0436	0.5652	8.9	4o48:B

[Back]