DLSLTNSSLMPTLNPMIQQLALAIAASWQSLPLKPYQLPEDLGYVEGRLEGEKLVIENRCYQTPQFRKMALELAKVGKGL
DILHCVMFPEPLYGLPLFGCDIVAGPGGVSAAIADLSPTQSDRQLPAAYQKSLAELGQPEFEQQRELPPWGEIFSEYCLF
IRPSNVTEEERFVQRVVDFLQIHCHQSIVAEPLSEAQTLEHRQGQIHYCQQQQKNDKTRRVLEKAFGEAWAERYMSQVLF
DV
The query sequence (length=242) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2d1e:A | 243 | 241 | 0.9917 | 0.9877 | 0.9959 | 2.84e-180 | 3ajg:A, 3ajg:B, 3ajh:A, 3ajh:B, 5b4h:A, 5b4i:A, 5b4j:A, 4eoc:A, 4eod:A, 4eoe:A, 3f0l:A, 3f0m:A, 3i8u:X, 3i94:A, 3i95:A, 3nb8:A, 3nb9:A, 4qcd:A, 7yk9:A, 7ykb:A |
2 | 6qx6:A | 264 | 211 | 0.2438 | 0.2235 | 0.2796 | 2.80e-18 | 6qx6:B |
3 | 2x9o:A | 233 | 212 | 0.2273 | 0.2361 | 0.2594 | 1.54e-11 | |
4 | 6kme:A | 284 | 176 | 0.1653 | 0.1408 | 0.2273 | 0.008 | 6kmd:A |
5 | 4zxa:W | 324 | 40 | 0.0579 | 0.0432 | 0.3500 | 0.38 | 4zxa:X, 4zxa:Y, 4zxa:Z, 4zxc:W, 4zxc:Z |
6 | 2vgr:C | 213 | 172 | 0.1529 | 0.1737 | 0.2151 | 0.47 | 2vck:A, 2vck:B, 2vck:C, 2vck:D, 2vgr:A, 2vgr:B, 2vgr:D, 2x9i:A, 2x9i:B, 2x9i:C, 2x9i:D, 2x9j:A, 2x9j:B |
7 | 1ao8:A | 162 | 29 | 0.0413 | 0.0617 | 0.3448 | 1.8 | 1bzf:A, 3dfr:A, 1dis:A, 1diu:A, 2hm9:A, 2hqp:A, 2lf1:A, 1lud:A |
8 | 4ac8:A | 311 | 44 | 0.0620 | 0.0482 | 0.3409 | 3.9 | 4ac8:B, 4ac8:C, 4ac8:D, 3ee4:A |
9 | 5d00:A | 361 | 77 | 0.0744 | 0.0499 | 0.2338 | 4.7 | 5d00:B, 5d01:A, 5d01:B |
10 | 3acl:A | 288 | 71 | 0.0909 | 0.0764 | 0.3099 | 5.3 | 4ero:A, 4ewa:A, 4ewd:A, 4ewe:A, 4gul:A, 6h1h:A, 6h1i:A, 4hlt:A, 1j1l:A, 5jct:A, 6n0j:A, 6n0k:A |
11 | 7zr1:D | 780 | 47 | 0.0661 | 0.0205 | 0.3404 | 6.5 | 7zr1:C |
12 | 6rxu:UT | 2033 | 42 | 0.0702 | 0.0084 | 0.4048 | 8.3 | 6rxv:UT, 6rxx:UT, 6rxz:UT |