DLPEIVASGDPVLHEKAREVDPGEIGSERIQKIIDDMIKVMRLAPGVGLAAPQIGVPLRIIVLEDTKEYISYAPKEEILA
QERRHFDLMVMVNPVLKERSNKKALFFEGCLSVDGFRAAVERYLEVVVTGYDRQGKRIEVNASGWQARILQHECDHLDGN
LYVDKMVPRTFRTVDNLDLPLAEGCPKLGSH
The query sequence (length=191) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4je6:A | 193 | 191 | 0.9895 | 0.9793 | 0.9895 | 1.25e-138 | 4je6:B, 4je7:A, 4je7:B, 4je8:A, 4je8:B, 1zxz:A, 1zxz:B, 1zy0:A, 1zy0:B, 1zy1:A, 1zy1:B |
2 | 3g5k:A | 183 | 170 | 0.3560 | 0.3716 | 0.4000 | 5.65e-39 | 3g5k:B, 3g5k:C, 3g5k:D, 3g5p:A, 3g5p:B, 3g5p:C, 3g5p:D |
3 | 1y6h:A | 177 | 165 | 0.3246 | 0.3503 | 0.3758 | 1.59e-30 | 1sv2:A, 1sv2:B, 1szz:A, 1szz:B, 1szz:C, 1szz:D, 1szz:E, 1szz:F, 1szz:G, 1szz:H, 1vev:A, 1vev:B, 1vey:A, 1vey:B, 1vez:A, 1vez:B, 1y6h:B |
4 | 6jfc:B | 161 | 164 | 0.3141 | 0.3727 | 0.3659 | 2.68e-28 | 6jfa:A, 6jfc:A, 6jfd:C, 6jfe:B, 6jff:B, 6jfn:B |
5 | 5kob:A | 171 | 161 | 0.3194 | 0.3567 | 0.3789 | 8.60e-28 | 5kob:B, 5kob:C, 5kob:D, 5vcp:A, 5vcp:B, 5vcp:C, 5vcp:D |
6 | 3cpm:A | 184 | 171 | 0.3141 | 0.3261 | 0.3509 | 4.01e-25 | 3m6o:A, 3m6o:B, 3m6p:A, 3m6p:B, 3m6q:A, 3m6r:A, 3m6r:B, 3m6r:C, 3m6r:D, 3o3j:A, 3pn2:A, 3pn3:A, 3pn3:B, 3pn4:A, 3pn5:A, 3pn6:A, 3pn6:B |
7 | 3qu1:A | 168 | 166 | 0.3141 | 0.3571 | 0.3614 | 7.62e-25 | 3qu1:B |
8 | 3uwb:A | 149 | 162 | 0.3141 | 0.4027 | 0.3704 | 1.21e-24 | 3uwa:A |
9 | 6ck7:A | 172 | 155 | 0.3351 | 0.3721 | 0.4129 | 1.24e-24 | 6ck7:B, 6ck7:C, 6ck7:D |
10 | 1ix1:A | 169 | 162 | 0.2984 | 0.3373 | 0.3519 | 1.13e-23 | 1ix1:B, 1lry:A, 1n5n:A, 1n5n:B, 1s17:A, 1s17:B |
11 | 5cy7:A | 171 | 164 | 0.2984 | 0.3333 | 0.3476 | 2.76e-22 | 5cp0:A, 5cpd:A, 5cvk:A, 5cvp:A, 5cvq:A, 5cwx:A, 5cwy:A, 5cx0:A, 5cxj:A, 5cy8:A, 6ikt:A, 6iky:A, 6il0:A, 6il2:A, 4nt8:A |
12 | 4wxl:C | 165 | 142 | 0.2723 | 0.3152 | 0.3662 | 3.99e-22 | 4wxl:A, 4wxl:B, 4wxl:D |
13 | 3fwx:A | 165 | 147 | 0.2827 | 0.3273 | 0.3673 | 7.25e-22 | 3fwx:B |
14 | 5j46:A | 169 | 167 | 0.3089 | 0.3491 | 0.3533 | 1.13e-21 | |
15 | 1bs4:A | 168 | 175 | 0.3403 | 0.3869 | 0.3714 | 1.21e-21 | 2ai8:A, 2ai8:B, 2ai8:C, 4al2:B, 4al3:A, 4az4:A, 1bs4:B, 1bs4:C, 1bs5:A, 1bs5:B, 1bs5:C, 1bs6:A, 1bs6:B, 1bs6:C, 1bs8:A, 1bs8:B, 1bs8:C, 1bsj:A, 1bsk:A, 1bsz:A, 1bsz:B, 1bsz:C, 7d6z:g, 1def:A, 2def:A, 1dff:A, 1g27:A, 1g27:B, 1g27:C, 1g2a:A, 1g2a:B, 1g2a:C, 3k6l:A, 3k6l:B, 2kmn:A, 1lru:A, 1lru:B, 1lru:C, 8ofe:A, 8rhr:A, 2w3t:A, 2w3u:A, 1xem:A, 1xen:A, 1xeo:A |
16 | 5hgw:A | 174 | 161 | 0.3298 | 0.3621 | 0.3913 | 1.35e-21 | 5hgw:B, 5i2b:A, 5t8z:A |
17 | 3e3u:A | 196 | 187 | 0.3351 | 0.3265 | 0.3422 | 2.85e-21 | |
18 | 6jes:A | 159 | 158 | 0.2984 | 0.3585 | 0.3608 | 3.94e-20 | 6jes:B, 6jf3:A, 6jf3:B, 6jf4:B, 6jf4:A, 6jf5:B, 6jf5:A, 6jf6:C, 6jf6:A, 6jf6:B, 6jf6:D, 6jf7:A, 6jf7:B, 6jf8:A, 6jf8:B, 6jf8:C, 6jf8:D |
19 | 1jym:A | 179 | 164 | 0.2670 | 0.2849 | 0.3110 | 4.45e-20 | 1jym:B, 1jym:C, 1jym:D, 1jym:E, 1jym:F, 1jym:G, 1jym:H, 1jym:I, 1jym:J, 1rl4:A, 1rl4:B, 1rqc:A, 1rqc:B, 1rqc:C, 1rqc:D, 1rqc:E, 1rqc:F, 1rqc:G, 1rqc:H, 1rqc:I, 1rqc:J |
20 | 3oca:A | 179 | 136 | 0.2461 | 0.2626 | 0.3456 | 5.38e-20 | 3oca:B, 3u04:A |
21 | 2ew5:A | 166 | 165 | 0.2775 | 0.3193 | 0.3212 | 7.54e-19 | 4e9a:A, 4e9b:A, 2ew6:A, 2ew7:A |
22 | 6jex:A | 172 | 164 | 0.2723 | 0.3023 | 0.3171 | 1.56e-18 | 6jer:A, 6jer:B, 6jet:A, 6jet:B, 6jeu:A, 6jeu:B, 6jev:A, 6jev:B, 6jew:A, 6jew:B, 6jex:B |
23 | 4dr8:A | 188 | 161 | 0.2880 | 0.2926 | 0.3416 | 9.93e-18 | 4dr8:B, 4dr8:C, 4dr8:D, 4dr9:A, 4dr9:B, 4dr9:C, 4dr9:D |
24 | 5mtc:A | 137 | 156 | 0.2827 | 0.3942 | 0.3462 | 3.08e-17 | 5mtc:B, 5mtd:A, 5mtd:B, 5mte:A, 5mte:B |
25 | 2os3:A | 205 | 192 | 0.3194 | 0.2976 | 0.3177 | 1.60e-16 | |
26 | 5jex:A | 203 | 181 | 0.2932 | 0.2759 | 0.3094 | 1.90e-16 | 5jez:A, 5jf0:A, 5jf1:A, 5jf2:A, 5jf3:A, 5jf4:A, 5jf5:A, 5jf6:A, 5jf7:A, 5jf8:A |
27 | 1lqy:A | 184 | 181 | 0.2984 | 0.3098 | 0.3149 | 1.82e-15 | |
28 | 1ws1:A | 151 | 140 | 0.2461 | 0.3113 | 0.3357 | 3.41e-15 | |
29 | 6ow7:P | 196 | 180 | 0.2984 | 0.2908 | 0.3167 | 1.28e-14 | 2ai7:A, 2aia:A, 2aie:P, 4eox:P, 1lm6:A, 6ow2:P, 6ow7:Q, 3str:P, 3svj:P, 3sw8:P |
30 | 1lm4:A | 190 | 178 | 0.2723 | 0.2737 | 0.2921 | 1.48e-13 | 6jfg:A, 6jfo:A, 6jfq:A, 6jfr:A, 6jfs:A, 1lm4:B, 1lmh:A, 1lqw:A, 1lqw:B, 1q1y:A, 3u7k:A, 3u7l:A, 3u7m:A, 3u7n:A |
31 | 3l87:A | 200 | 184 | 0.2984 | 0.2850 | 0.3098 | 1.52e-13 | |
32 | 2okl:A | 185 | 181 | 0.2670 | 0.2757 | 0.2818 | 2.30e-13 | 2okl:B |
33 | 3cmd:B | 188 | 178 | 0.2723 | 0.2766 | 0.2921 | 4.78e-13 | 3cmd:A, 3g6n:A, 3g6n:B |
34 | 2os1:A | 179 | 180 | 0.2670 | 0.2849 | 0.2833 | 3.90e-11 | |
35 | 5meh:A | 438 | 186 | 0.2356 | 0.1027 | 0.2419 | 4.3 | 4ayp:A, 4ayq:A, 4ayr:A, 8b5m:A, 5ne5:A |
36 | 8btd:SC | 210 | 36 | 0.0733 | 0.0667 | 0.3889 | 7.7 | 8br8:SC, 8brm:SC, 8bsi:SC, 8bsj:SC, 8btr:SC, 8fvy:D, 8g4s:D, 7pwf:D, 7pwo:D1 |
37 | 8kdb:A | 2117 | 89 | 0.1309 | 0.0118 | 0.2809 | 9.5 | 8kdc:A |