DLPEIVASGDPVLHEKAREVDPGEIGSERIQKIIDDMIKVMRLAPCVGLAAPQIGVPLRIIVLEDTKEYISYAPKEEILA
QERRHFDLMVMVNPVLKERSNKKALFFEGCESVDGFRAAVERYLEVVVTGYDRQGKRIEVNASGWQARILQHECDHLDGN
LYVDKMVPRTFRTVDNLDLPLAEGCPKLGSHHH
The query sequence (length=193) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4je6:A | 193 | 193 | 1.0000 | 1.0000 | 1.0000 | 2.12e-143 | 4je6:B, 4je7:A, 4je7:B, 4je8:A, 4je8:B, 1zxz:A, 1zxz:B, 1zy0:A, 1zy0:B, 1zy1:A, 1zy1:B |
2 | 3g5k:A | 183 | 166 | 0.3627 | 0.3825 | 0.4217 | 8.58e-42 | 3g5k:B, 3g5k:C, 3g5k:D, 3g5p:A, 3g5p:B, 3g5p:C, 3g5p:D |
3 | 1y6h:A | 177 | 165 | 0.3109 | 0.3390 | 0.3636 | 3.42e-28 | 1sv2:A, 1sv2:B, 1szz:A, 1szz:B, 1szz:C, 1szz:D, 1szz:E, 1szz:F, 1szz:G, 1szz:H, 1vev:A, 1vev:B, 1vey:A, 1vey:B, 1vez:A, 1vez:B, 1y6h:B |
4 | 6jfc:B | 161 | 164 | 0.3005 | 0.3602 | 0.3537 | 4.78e-26 | 6jfa:A, 6jfc:A, 6jfd:C, 6jfe:B, 6jff:B, 6jfn:B |
5 | 5kob:A | 171 | 161 | 0.3057 | 0.3450 | 0.3665 | 1.18e-25 | 5kob:B, 5kob:C, 5kob:D, 5vcp:A, 5vcp:B, 5vcp:C, 5vcp:D |
6 | 3cpm:A | 184 | 171 | 0.3005 | 0.3152 | 0.3392 | 7.16e-23 | 3m6o:A, 3m6o:B, 3m6p:A, 3m6p:B, 3m6q:A, 3m6r:A, 3m6r:B, 3m6r:C, 3m6r:D, 3o3j:A, 3pn2:A, 3pn3:A, 3pn3:B, 3pn4:A, 3pn5:A, 3pn6:A, 3pn6:B |
7 | 3qu1:A | 168 | 166 | 0.3005 | 0.3452 | 0.3494 | 1.33e-22 | 3qu1:B |
8 | 6ck7:A | 172 | 155 | 0.3212 | 0.3605 | 0.4000 | 2.99e-22 | 6ck7:B, 6ck7:C, 6ck7:D |
9 | 3uwb:A | 149 | 162 | 0.3005 | 0.3893 | 0.3580 | 4.84e-22 | 3uwa:A |
10 | 1ix1:A | 169 | 162 | 0.2850 | 0.3254 | 0.3395 | 2.83e-21 | 1ix1:B, 1lry:A, 1n5n:A, 1n5n:B, 1s17:A, 1s17:B |
11 | 5cy7:A | 171 | 164 | 0.2850 | 0.3216 | 0.3354 | 3.75e-20 | 5cp0:A, 5cpd:A, 5cvk:A, 5cvp:A, 5cvq:A, 5cwx:A, 5cwy:A, 5cx0:A, 5cxj:A, 5cy8:A, 6ikt:A, 6iky:A, 6il0:A, 6il2:A, 4nt8:A |
12 | 4wxl:C | 165 | 142 | 0.2591 | 0.3030 | 0.3521 | 8.04e-20 | 4wxl:A, 4wxl:B, 4wxl:D |
13 | 5hgw:A | 174 | 161 | 0.3109 | 0.3448 | 0.3727 | 1.84e-19 | 5hgw:B, 5i2b:A, 5t8z:A |
14 | 3fwx:A | 165 | 147 | 0.2694 | 0.3152 | 0.3537 | 1.92e-19 | 3fwx:B |
15 | 1bs4:A | 168 | 175 | 0.3264 | 0.3750 | 0.3600 | 3.49e-19 | 2ai8:A, 2ai8:B, 2ai8:C, 4al2:B, 4al3:A, 4az4:A, 1bs4:B, 1bs4:C, 1bs5:A, 1bs5:B, 1bs5:C, 1bs6:A, 1bs6:B, 1bs6:C, 1bs8:A, 1bs8:B, 1bs8:C, 1bsj:A, 1bsk:A, 1bsz:A, 1bsz:B, 1bsz:C, 7d6z:g, 1def:A, 2def:A, 1dff:A, 1g27:A, 1g27:B, 1g27:C, 1g2a:A, 1g2a:B, 1g2a:C, 3k6l:A, 3k6l:B, 2kmn:A, 1lru:A, 1lru:B, 1lru:C, 8ofe:A, 8rhr:A, 2w3t:A, 2w3u:A, 1xem:A, 1xen:A, 1xeo:A |
16 | 5j46:A | 169 | 167 | 0.2953 | 0.3373 | 0.3413 | 3.49e-19 | |
17 | 3e3u:A | 196 | 187 | 0.3212 | 0.3163 | 0.3316 | 3.64e-19 | |
18 | 1jym:A | 179 | 164 | 0.2539 | 0.2737 | 0.2988 | 8.41e-18 | 1jym:B, 1jym:C, 1jym:D, 1jym:E, 1jym:F, 1jym:G, 1jym:H, 1jym:I, 1jym:J, 1rl4:A, 1rl4:B, 1rqc:A, 1rqc:B, 1rqc:C, 1rqc:D, 1rqc:E, 1rqc:F, 1rqc:G, 1rqc:H, 1rqc:I, 1rqc:J |
19 | 6jes:A | 159 | 158 | 0.2850 | 0.3459 | 0.3481 | 1.00e-17 | 6jes:B, 6jf3:A, 6jf3:B, 6jf4:B, 6jf4:A, 6jf5:B, 6jf5:A, 6jf6:C, 6jf6:A, 6jf6:B, 6jf6:D, 6jf7:A, 6jf7:B, 6jf8:A, 6jf8:B, 6jf8:C, 6jf8:D |
20 | 3oca:A | 179 | 136 | 0.2332 | 0.2514 | 0.3309 | 1.74e-17 | 3oca:B, 3u04:A |
21 | 2ew5:A | 166 | 165 | 0.2642 | 0.3072 | 0.3091 | 2.18e-16 | 4e9a:A, 4e9b:A, 2ew6:A, 2ew7:A |
22 | 6jex:A | 172 | 164 | 0.2591 | 0.2907 | 0.3049 | 4.22e-16 | 6jer:A, 6jer:B, 6jet:A, 6jet:B, 6jeu:A, 6jeu:B, 6jev:A, 6jev:B, 6jew:A, 6jew:B, 6jex:B |
23 | 4dr8:A | 188 | 161 | 0.2746 | 0.2819 | 0.3292 | 2.15e-15 | 4dr8:B, 4dr8:C, 4dr8:D, 4dr9:A, 4dr9:B, 4dr9:C, 4dr9:D |
24 | 5mtc:A | 137 | 156 | 0.2694 | 0.3796 | 0.3333 | 7.10e-15 | 5mtc:B, 5mtd:A, 5mtd:B, 5mte:A, 5mte:B |
25 | 2os3:A | 205 | 192 | 0.3057 | 0.2878 | 0.3073 | 3.30e-14 | |
26 | 5jex:A | 203 | 181 | 0.2798 | 0.2660 | 0.2983 | 3.43e-14 | 5jez:A, 5jf0:A, 5jf1:A, 5jf2:A, 5jf3:A, 5jf4:A, 5jf5:A, 5jf6:A, 5jf7:A, 5jf8:A |
27 | 1lqy:A | 184 | 181 | 0.2850 | 0.2989 | 0.3039 | 3.32e-13 | |
28 | 1ws1:A | 151 | 140 | 0.2332 | 0.2980 | 0.3214 | 3.93e-13 | |
29 | 6ow7:P | 196 | 180 | 0.2850 | 0.2806 | 0.3056 | 1.86e-12 | 2ai7:A, 2aia:A, 2aie:P, 4eox:P, 1lm6:A, 6ow2:P, 6ow7:Q, 3str:P, 3svj:P, 3sw8:P |
30 | 1lm4:A | 190 | 178 | 0.2591 | 0.2632 | 0.2809 | 1.58e-11 | 6jfg:A, 6jfo:A, 6jfq:A, 6jfr:A, 6jfs:A, 1lm4:B, 1lmh:A, 1lqw:A, 1lqw:B, 1q1y:A, 3u7k:A, 3u7l:A, 3u7m:A, 3u7n:A |
31 | 3l87:A | 200 | 184 | 0.2850 | 0.2750 | 0.2989 | 2.58e-11 | |
32 | 2okl:A | 185 | 181 | 0.2539 | 0.2649 | 0.2707 | 3.82e-11 | 2okl:B |
33 | 3cmd:B | 188 | 178 | 0.2591 | 0.2660 | 0.2809 | 1.02e-10 | 3cmd:A, 3g6n:A, 3g6n:B |
34 | 2os1:A | 179 | 180 | 0.2539 | 0.2737 | 0.2722 | 6.98e-09 | |
35 | 5meh:A | 438 | 182 | 0.2280 | 0.1005 | 0.2418 | 5.2 | 4ayp:A, 4ayq:A, 4ayr:A, 8b5m:A, 5ne5:A |
36 | 8kdb:A | 2117 | 89 | 0.1295 | 0.0118 | 0.2809 | 6.0 | 8kdc:A |
37 | 8btd:SC | 210 | 36 | 0.0725 | 0.0667 | 0.3889 | 7.1 | 8br8:SC, 8brm:SC, 8bsi:SC, 8bsj:SC, 8btr:SC, 8fvy:D, 8g4s:D, 7pwf:D, 7pwo:D1 |
38 | 3x2f:A | 406 | 30 | 0.0674 | 0.0320 | 0.4333 | 9.2 | 5tov:B, 5tow:B, 3x2e:A, 3x2e:B, 3x2e:C, 3x2e:D, 3x2f:B |