DLKKIESYLDKLRIKEKDGEERKIYAEVLDGRTLKTLYKLSAKGYITAMGGVISTGKEANVFYADGVFDGKPVAMAVKIY
RIEDKMDEYLYGDERFDMRRISPKEKVFIWTEKEFRNLERAKEAGVSVPQPYTYMKNVLLMEFIGEDELPAPTLVELGRE
LKELDVEGIFNDVVENVKRLYQEAELVHADLSEYNIMYIDKVYFIDMGQAVTLRHPMAESYLERDVRNIIRFFSKYGVKA
DFEEMLKEVKGE
The query sequence (length=252) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4jin:A | 254 | 254 | 0.9921 | 0.9843 | 0.9843 | 1.18e-180 | 3re4:A, 3re4:B, 1zp9:A, 1zp9:B, 1zp9:C, 1zp9:D, 1ztf:A, 1zth:A, 1zth:B, 1zth:C, 1zth:D |
2 | 6zxf:z | 373 | 229 | 0.3571 | 0.2413 | 0.3930 | 8.38e-47 | 6zxg:z, 6zxh:z |
3 | 6zxd:z | 292 | 217 | 0.3294 | 0.2842 | 0.3825 | 7.41e-44 | 4otp:A, 6zv6:h, 6zxe:z |
4 | 1zao:A | 271 | 238 | 0.2619 | 0.2435 | 0.2773 | 1.35e-16 | 1tqm:A, 1tqp:A, 1zar:A |
5 | 6g18:v | 325 | 220 | 0.2222 | 0.1723 | 0.2545 | 2.73e-13 | 6fdm:A, 6fdm:C, 6g51:v, 6hk6:A, 6hk6:B, 6hk6:I, 6hk6:C, 6hk6:D, 6hk6:E, 6hk6:F, 6hk6:G, 6hk6:H, 6hk6:J, 7vbt:A, 7vbt:B, 7wu0:v |
6 | 8cbj:l | 286 | 243 | 0.2460 | 0.2168 | 0.2551 | 1.06e-11 | 6eml:r, 6fai:l, 6rbd:l, 6y7c:l |
7 | 4gyi:A | 339 | 218 | 0.2183 | 0.1622 | 0.2523 | 3.04e-10 | |
8 | 8c01:r | 239 | 127 | 0.1429 | 0.1506 | 0.2835 | 7.22e-10 | 8c00:r |
9 | 7o7j:A | 368 | 64 | 0.0794 | 0.0543 | 0.3125 | 0.25 | |
10 | 7sza:A | 233 | 151 | 0.1667 | 0.1803 | 0.2781 | 0.62 | 7sza:C, 7szb:A, 7szb:C, 7szc:A, 7szc:C, 7szd:A, 7szd:C, 6wqx:C, 6wqx:D |
11 | 3apt:A | 292 | 101 | 0.1032 | 0.0890 | 0.2574 | 0.78 | 3apy:A, 3apy:B, 3apy:C, 3apy:D, 3apy:E, 3apy:F, 3apy:G, 3apy:H, 8eac:A, 7th4:A, 7th4:B, 7th5:A, 7th5:B, 1v93:A |
12 | 7ncf:A | 355 | 44 | 0.0635 | 0.0451 | 0.3636 | 0.95 | 6p5s:A |
13 | 6hqv:A | 1555 | 61 | 0.0794 | 0.0129 | 0.3279 | 2.1 | 6hqv:B |
14 | 4o6h:B | 204 | 56 | 0.0675 | 0.0833 | 0.3036 | 2.1 | 8cnl:B, 8cnl:A, 8cnl:C, 8cnl:D, 8cnl:E, 8cnl:F, 8cnl:G, 8cnl:H, 4o6h:A, 4o6h:C, 4o6h:D, 4o6h:E, 4o6h:F, 4o6h:G, 4o6h:H, 4o6i:A, 4o6i:B |
15 | 6no5:A | 239 | 50 | 0.0675 | 0.0711 | 0.3400 | 2.9 | 6no0:A, 6no0:B, 6no1:A, 6no2:A, 6no2:B, 6no3:A, 6no3:B, 6no4:A, 6no5:B, 6no5:C, 6no5:D |
16 | 8h4r:A | 287 | 81 | 0.0833 | 0.0732 | 0.2593 | 3.6 | |
17 | 7tom:A | 498 | 66 | 0.0595 | 0.0301 | 0.2273 | 6.9 | 7tol:A |