DLKASSLRALKLMDLSTDYTDEKVIALCHQAKTPVGNTAAISIYPRSIPIARKTLKEQGTPEIRIATVTNFPHGNDDIEI
ALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIESGELKDEALIRKASEISIKAGADF
IKTSTGLVAVNATPESARIMMEVIRDMGVEKSVGFKVTGGARTAEDAQKYLAIADELFGADWADARHYRFGASGLLASLL
KALGHG
The query sequence (length=246) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1jcj:A | 252 | 249 | 0.9472 | 0.9246 | 0.9357 | 4.94e-150 | 5eky:A, 5el1:A, 5emu:A, 8for:A, 8for:B, 8for:C, 8for:D, 8for:E, 8for:F, 1jcj:B, 1jcl:A, 1jcl:B, 7p76:A, 7p76:B, 7p76:C, 7p76:D, 7p76:E, 7p76:F, 7p76:G, 7p76:H, 7p76:I, 7p76:J, 7p76:K, 7p76:L, 3q2d:A, 3q2d:B, 6z9i:B |
2 | 3ngj:D | 222 | 197 | 0.2602 | 0.2883 | 0.3249 | 2.60e-19 | 3ngj:A, 3ngj:B, 3ngj:C |
3 | 1ub3:A | 211 | 149 | 0.2195 | 0.2559 | 0.3624 | 2.25e-14 | 1ub3:B, 1ub3:C, 1ub3:D |
4 | 3qyq:A | 273 | 214 | 0.2480 | 0.2234 | 0.2850 | 3.35e-13 | 3qyq:B |
5 | 5lst:A | 617 | 46 | 0.0650 | 0.0259 | 0.3478 | 0.53 | |
6 | 3i4l:A | 524 | 50 | 0.0732 | 0.0344 | 0.3600 | 0.61 | 3i73:A |
7 | 8onj:A | 277 | 63 | 0.0813 | 0.0722 | 0.3175 | 0.95 | 8ahr:A, 8ahr:B, 8aie:A, 8aie:B, 8ayj:A, 8ayj:B, 8ayk:A, 8ayk:B, 8onj:B, 8onl:A, 8onl:B, 8onm:A, 8onm:B, 8onn:A, 8onn:B, 8onn:C, 8onn:D |
8 | 1rm6:A | 761 | 56 | 0.0732 | 0.0237 | 0.3214 | 4.2 | 1rm6:D, 1sb3:A, 1sb3:D |
9 | 2dfy:X | 158 | 60 | 0.0772 | 0.1203 | 0.3167 | 4.5 | 2dfy:C, 1rut:X |
10 | 4hnn:F | 320 | 67 | 0.0772 | 0.0594 | 0.2836 | 5.0 | 4hnn:A, 4hnn:B, 4hnn:C, 4hnn:D, 4hnn:E, 4hnn:G, 4hnn:H |
11 | 3al0:C | 564 | 98 | 0.1057 | 0.0461 | 0.2653 | 5.2 | 3afh:A, 3akz:B, 3akz:D, 3akz:C, 3akz:A |
12 | 5ey5:A | 261 | 70 | 0.0813 | 0.0766 | 0.2857 | 6.7 | 5ey5:C |
13 | 6xfr:B | 216 | 51 | 0.0610 | 0.0694 | 0.2941 | 8.7 | 6xfr:A |
14 | 7c79:B | 793 | 52 | 0.0650 | 0.0202 | 0.3077 | 9.5 | 6agb:B, 6ah3:B, 7c7a:B, 6w6v:B |