DLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCP
KIVNL
The query sequence (length=85) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7dvq:6 | 105 | 85 | 1.0000 | 0.8095 | 1.0000 | 8.16e-57 | 7abg:y, 7abh:y, 7abi:y, 7b0i:D, 7b91:D, 7b92:D, 7b9c:D, 8ch6:D, 6en4:D, 7evn:D, 7evo:6, 6ff4:y, 8hk1:6, 8i0p:7, 8i0r:7, 8i0s:7, 8i0t:7, 8i0u:7, 8i0v:7, 5ife:D, 7omf:D, 7onb:D, 7opi:D, 7q3l:G, 7q4o:G, 7q4p:G, 7qtt:D, 6qx9:BP, 8r08:BP, 5syb:A, 5syb:B, 7vpx:6, 6y50:y, 8y7e:6, 5z56:6, 5z57:6, 5z58:6, 5zya:D |
2 | 2k0a:A | 109 | 86 | 0.6000 | 0.4679 | 0.5930 | 5.73e-29 | 7dco:5, 6g90:S, 5gm6:J, 5lqw:Y, 5nrl:S, 5zwm:5 |
3 | 8fo9:F | 2289 | 70 | 0.2588 | 0.0096 | 0.3143 | 0.034 | 9c61:A, 9c61:B, 8fo2:E, 8fo7:C, 8fo8:C, 8fo8:E, 8fo9:E, 7lht:A, 7lht:B, 7lhw:A, 7li3:A, 7li4:A, 6oje:A, 6oje:B, 6ojf:A, 6ojf:B, 7thy:A, 7thz:A, 6xaf:A, 6xaf:B, 2zej:B |
4 | 8tzf:A | 1589 | 86 | 0.2824 | 0.0151 | 0.2791 | 0.043 | |
5 | 8u8b:A | 1712 | 70 | 0.2706 | 0.0134 | 0.3286 | 0.056 | 8u7l:B, 8u7l:A, 8u8a:B, 8u8a:C, 8u8b:B, 2zej:A |
6 | 5c2v:D | 770 | 23 | 0.1529 | 0.0169 | 0.5652 | 0.063 | 5c2v:A, 5c2w:A, 5c2w:D |
7 | 9bct:I | 65 | 54 | 0.1765 | 0.2308 | 0.2778 | 0.14 | |
8 | 6qf7:B | 244 | 26 | 0.1294 | 0.0451 | 0.4231 | 1.7 | 6b74:B, 6b77:B, 6l63:A, 6l63:C, 6qf7:D, 8r8d:B, 8r8d:A, 6x0s:A, 6x0s:B, 6x0s:C, 6x0t:A, 6x0t:B, 6x0t:C |
9 | 8j56:C | 160 | 39 | 0.2000 | 0.1062 | 0.4359 | 3.5 | 8j56:F |
10 | 1ryq:A | 64 | 28 | 0.0941 | 0.1250 | 0.2857 | 3.8 | 8oki:I, 8p2i:I, 3p8b:A, 3p8b:C, 3qqc:E |
11 | 6cnb:B | 1114 | 19 | 0.0941 | 0.0072 | 0.4211 | 5.1 | 8bws:B, 6cnc:B, 6cnd:B, 6cnf:B, 6eu0:B, 6eu1:B, 6f40:B, 6f41:B, 6f42:B, 6f44:B, 5fj8:B, 5fja:B, 6tut:B, 7z0h:B, 7z1l:B, 7z1m:B, 7z1n:B, 7z1o:B, 7z2z:B, 7z30:B, 7z31:B |
12 | 6ukj:A | 350 | 71 | 0.2353 | 0.0571 | 0.2817 | 6.8 |