DLDLQRVGARLAARAQIRDIRLLRTQAAVHRAPKQGLTYDLEFEPAVDADPATISAFVVRISCHLRIQNQADVATADFEF
AALFDYHLQEGEDDPTEEELTAYAATTGRFALYPYIREYVYDLTGRLALPPLTLEILS
The query sequence (length=138) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5mtw:C | 138 | 138 | 0.9493 | 0.9493 | 0.9493 | 1.95e-85 | 5mtw:A, 5mtw:D, 5mtw:B |
2 | 5hxm:A | 1060 | 59 | 0.1377 | 0.0179 | 0.3220 | 1.2 | 5f7u:A, 5hpo:A, 5i0d:A, 5i0d:B, 4kmq:A, 4kwu:A |
3 | 4j0h:A | 470 | 48 | 0.1232 | 0.0362 | 0.3542 | 2.1 | 4j0h:B, 4j0j:A, 4j0j:B, 4j0k:A, 4j0k:B, 4jui:A, 4jui:B, 3wa7:A |
4 | 1ozb:A | 144 | 127 | 0.2174 | 0.2083 | 0.2362 | 2.4 | 1ozb:B, 1ozb:C, 1ozb:D |