DKYRRVPMLLKPQQGGQQYFNHFLIRSTNDRLTQQDVDNA
The query sequence (length=40) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7pua:CK | 177 | 40 | 1.0000 | 0.2260 | 1.0000 | 7.15e-24 | |
2 | 6sgb:CK | 211 | 40 | 1.0000 | 0.1896 | 1.0000 | 2.50e-23 | |
3 | 7pub:CK | 298 | 40 | 1.0000 | 0.1342 | 1.0000 | 6.91e-23 | 6hiv:CK, 6hiw:CK, 6hiy:CK, 6hiz:CK, 6sg9:CK, 6sga:CK |
4 | 7ane:f | 148 | 35 | 0.7000 | 0.1892 | 0.8000 | 3.85e-14 | |
5 | 7cny:A | 253 | 39 | 0.3250 | 0.0514 | 0.3333 | 1.6 | 7cny:C |
6 | 4chu:B | 127 | 20 | 0.2500 | 0.0787 | 0.5000 | 2.7 | |
7 | 7och:L | 1181 | 17 | 0.2250 | 0.0076 | 0.5294 | 2.8 | |
8 | 7ela:A | 1402 | 17 | 0.2250 | 0.0064 | 0.5294 | 3.0 | |
9 | 7oe3:L | 1478 | 17 | 0.2250 | 0.0061 | 0.5294 | 3.0 | 7oea:L, 7oeb:L |
10 | 7ojj:L | 1785 | 17 | 0.2250 | 0.0050 | 0.5294 | 3.0 | |
11 | 7ojn:L | 2010 | 17 | 0.2250 | 0.0045 | 0.5294 | 3.0 | 5j1n:A, 5j1p:A, 4miw:A, 7oe7:L |
12 | 7ckl:A | 1415 | 17 | 0.2250 | 0.0064 | 0.5294 | 3.2 | |
13 | 6klc:A | 1436 | 17 | 0.2250 | 0.0063 | 0.5294 | 3.4 | |
14 | 7ojk:L | 1843 | 17 | 0.2250 | 0.0049 | 0.5294 | 3.6 | |
15 | 7ojl:L | 1498 | 17 | 0.2250 | 0.0060 | 0.5294 | 4.0 | |
16 | 2gsk:A | 590 | 29 | 0.2750 | 0.0186 | 0.3793 | 6.4 | 3m8d:A, 1nqg:A, 1nqh:A, 1ujw:A |