BioLiP

>protein
DKQWERFLVPYRQAVEELKVKLKGIRTLYEYEDDHSPIEFVTGRVKPVASILEKARRKSIPLHEIETMQDIAGLRIMCQF
VDDIQIVKEMLFARKDFTVVDQRDYIASYHLVVLYPLQTVSGEKHVLVEIQIRTLAMNFWATIEHSLNYKYSGNIPEKVK
LRLQRASEAASRLDEEMSEIRGEVQEA

The query sequence (length=187) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5ded:A	196	195	1.0000	0.9541	0.9590	1.28e-135	5ded:D, 5ded:B, 5ded:C, 5ded:E, 5ded:F, 5ded:G, 5ded:H, 5f2v:V, 5f2v:X, 5f2v:T, 5f2v:S, 5f2v:Y, 5f2v:O, 5f2v:Z, 5f2v:W, 5f2v:U, 5f2v:P, 5f2v:R, 5f2v:Q
2	6ewz:A	202	187	0.3102	0.2871	0.3102	1.01e-26	6ewz:B, 6ex0:A, 6ex0:B, 6fgx:A, 6fgx:B
3	5xnx:D	321	112	0.1658	0.0966	0.2768	0.13	5xnx:C
4	5ux2:A	220	54	0.0963	0.0818	0.3333	2.7	5ux2:B
5	7mxw:Z	350	73	0.1070	0.0571	0.2740	3.6	7mxq:Z, 7mxr:Z, 7mxs:Z, 7mxt:Z, 7mxu:Z, 7mxv:Z, 7mxx:Z, 3qe9:Y, 3qe9:Z, 3qea:Z, 3qeb:Z, 5uzv:Z, 5v04:Z, 5v05:Z, 5v06:Z, 5v07:Z, 5v08:Z, 5v09:Z, 5v0a:Z, 5v0b:Z, 5v0c:Z, 5v0d:Z, 5v0e:Z
6	1ae1:B	258	37	0.0642	0.0465	0.3243	4.1	1ae1:A
7	6yxa:A	536	105	0.1551	0.0541	0.2762	4.3	8acu:A, 8acu:B
8	3adr:A	259	53	0.0909	0.0656	0.3208	6.7	3adr:B
9	5lbp:A	196	45	0.0642	0.0612	0.2667	7.2	5l9k:A, 5l9k:B, 5l9q:A, 5l9q:B, 5lau:A

[Back]