BioLiP

>protein
DKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKV
KKTAESKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEEC
SGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPP

The query sequence (length=221) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8g0h:C	227	222	1.0000	0.9736	0.9955	1.05e-164	4av1:A, 4av1:C, 4dqy:D, 4dqy:A, 4dqy:B, 4dqy:E, 8g0h:A, 2jvn:A, 3od8:A, 3od8:B, 3od8:C, 3od8:E, 3od8:G, 3od8:H, 3oda:A, 3oda:B, 3oda:C, 3oda:E, 3oda:G, 3oda:H, 4opx:D, 4opx:A, 4oqa:D, 4oqa:A, 4oqb:D, 4oqb:A, 2riq:A, 7s68:A, 7s6h:C, 7s6h:A, 7s6m:A, 7s6m:C, 7s81:I, 7s81:F, 7s81:G, 7s81:O, 7s81:J, 7s81:B
2	2dmj:A	106	86	0.3846	0.8019	0.9884	1.73e-60
3	2n8a:A	214	120	0.4163	0.4299	0.7667	6.36e-60	4av1:D, 4av1:B, 2l30:A, 2l31:A, 3od8:D, 3od8:F, 3oda:D, 3oda:F, 3odc:A, 3odc:B, 3ode:A, 3ode:B, 7s81:N, 7s81:A
4	2n8a:A	214	85	0.1312	0.1355	0.3412	3.78e-07	4av1:D, 4av1:B, 2l30:A, 2l31:A, 3od8:D, 3od8:F, 3oda:D, 3oda:F, 3odc:A, 3odc:B, 3ode:A, 3ode:B, 7s81:N, 7s81:A
5	1v9x:A	114	85	0.1855	0.3596	0.4824	2.65e-20
6	2cs2:A	134	86	0.1312	0.2164	0.3372	2.83e-08
7	1uw0:A	117	79	0.1131	0.2137	0.3165	1.05e-07
8	2w4l:C	142	117	0.1086	0.1690	0.2051	0.25
9	7x07:A	633	59	0.0769	0.0269	0.2881	0.60	7shn:A, 7shn:B, 7vzb:A, 7vzb:B, 7x0t:A, 7x0t:B, 7x1w:A, 7x1w:B, 7xec:A, 7yrq:A, 7yrq:B
10	8ova:A1	262	76	0.0905	0.0763	0.2632	1.2	8ove:A1, 4v8m:A1
11	5cr9:A	290	114	0.1312	0.1000	0.2544	1.4
12	4u3e:A	637	84	0.0905	0.0314	0.2381	9.7	4coi:A, 4coi:B, 4coj:A, 4coj:B, 4col:A, 4col:B, 4com:A, 4com:B, 4u3e:B
13	7jx0:A	801	71	0.0950	0.0262	0.2958	10.0	3qjz:A

[Back]