DKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKV
KKTAEAEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG
QLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPP
The query sequence (length=219) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8g0h:C | 227 | 222 | 1.0000 | 0.9648 | 0.9865 | 1.95e-163 | 4av1:A, 4av1:C, 4dqy:D, 4dqy:A, 4dqy:B, 4dqy:E, 8g0h:A, 2jvn:A, 3od8:A, 3od8:B, 3od8:C, 3od8:E, 3od8:G, 3od8:H, 3oda:A, 3oda:B, 3oda:C, 3oda:E, 3oda:G, 3oda:H, 4opx:D, 4opx:A, 4oqa:D, 4oqa:A, 4oqb:D, 4oqb:A, 2riq:A, 7s68:A, 7s6h:C, 7s6h:A, 7s6m:A, 7s6m:C, 7s81:I, 7s81:F, 7s81:G, 7s81:O, 7s81:J, 7s81:B |
2 | 2dmj:A | 106 | 86 | 0.3927 | 0.8113 | 1.0000 | 4.64e-61 | |
3 | 2n8a:A | 214 | 120 | 0.4247 | 0.4346 | 0.7750 | 1.91e-60 | 4av1:D, 4av1:B, 2l30:A, 2l31:A, 3od8:D, 3od8:F, 3oda:D, 3oda:F, 3odc:A, 3odc:B, 3ode:A, 3ode:B, 7s81:N, 7s81:A |
4 | 2n8a:A | 214 | 85 | 0.1324 | 0.1355 | 0.3412 | 3.62e-07 | 4av1:D, 4av1:B, 2l30:A, 2l31:A, 3od8:D, 3od8:F, 3oda:D, 3oda:F, 3odc:A, 3odc:B, 3ode:A, 3ode:B, 7s81:N, 7s81:A |
5 | 1v9x:A | 114 | 85 | 0.1826 | 0.3509 | 0.4706 | 5.38e-20 | |
6 | 2cs2:A | 134 | 85 | 0.1324 | 0.2164 | 0.3412 | 2.68e-08 | |
7 | 1uw0:A | 117 | 79 | 0.1142 | 0.2137 | 0.3165 | 9.97e-08 | |
8 | 6v3q:A | 226 | 106 | 0.1233 | 0.1195 | 0.2547 | 0.41 | 6v3q:B |
9 | 2w4l:C | 142 | 104 | 0.1050 | 0.1620 | 0.2212 | 0.89 | |
10 | 8ova:A1 | 262 | 76 | 0.0913 | 0.0763 | 0.2632 | 1.2 | 8ove:A1, 4v8m:A1 |
11 | 8sq0:A | 1402 | 45 | 0.0731 | 0.0114 | 0.3556 | 7.2 | 8sq0:B, 8sql:A, 8sqm:A |