DKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTYIIGELH
PDDRSKIAKPSETL
The query sequence (length=94) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1aw3:A | 94 | 94 | 1.0000 | 1.0000 | 1.0000 | 2.38e-65 | 1axx:A, 2axx:A, 1b5a:A, 1b5b:A, 1bfx:A, 1blv:A, 1do9:A, 1mny:A |
2 | 1hko:A | 104 | 93 | 0.8936 | 0.8077 | 0.9032 | 1.19e-59 | 1aqa:A, 1cyo:A, 1ehb:A, 1es1:A, 1f03:A, 1f04:A, 1i5u:A, 1ib7:A, 1j0q:A, 1jex:A, 1lqx:A, 1lr6:A, 1m20:A, 1m2i:A, 1m2m:A, 1m59:A, 1nx7:A, 1sh4:A, 1u9m:A, 1u9m:B, 1u9m:C, 1u9m:D, 1u9m:E, 1u9m:F, 1u9u:A, 3x32:A, 3x33:A, 3x34:A, 3x35:A |
3 | 2i96:A | 108 | 94 | 0.8830 | 0.7685 | 0.8830 | 1.78e-58 | 4hin:A, 4hin:B, 4hin:C, 4hin:D, 2m33:A |
4 | 3ozz:B | 82 | 81 | 0.6915 | 0.7927 | 0.8025 | 2.11e-46 | |
5 | 2i89:A | 90 | 83 | 0.6277 | 0.6556 | 0.7108 | 2.36e-41 | 2i89:B, 2i89:C, 2i89:D, 1icc:A, 1icc:B, 1icc:D, 1lj0:A, 1lj0:B, 1lj0:C, 1lj0:D, 3mus:B |
6 | 1awp:A | 86 | 83 | 0.5319 | 0.5814 | 0.6024 | 3.93e-35 | 1awp:B, 1b5m:A, 1eue:A, 1eue:B, 4hil:A, 4hil:B, 1icc:C, 3mus:A |
7 | 3ner:B | 91 | 80 | 0.5319 | 0.5495 | 0.6250 | 4.02e-34 | 3ner:A |
8 | 2ibj:A | 86 | 84 | 0.5426 | 0.5930 | 0.6071 | 1.82e-33 | |
9 | 4b8n:B | 90 | 74 | 0.3298 | 0.3444 | 0.4189 | 8.19e-13 | 4b8n:A, 4b8n:C, 4b8n:D |
10 | 1cxy:A | 81 | 80 | 0.2872 | 0.3333 | 0.3375 | 6.46e-12 | |
11 | 8tgb:A | 108 | 76 | 0.2553 | 0.2222 | 0.3158 | 2.05e-11 | 8tgb:B |
12 | 3lf5:A | 87 | 72 | 0.2553 | 0.2759 | 0.3333 | 2.33e-11 | 3lf5:B |
13 | 7bwh:A | 88 | 79 | 0.2979 | 0.3182 | 0.3544 | 3.09e-11 | |
14 | 1kbi:A | 504 | 51 | 0.2447 | 0.0456 | 0.4510 | 4.49e-11 | 1fcb:A, 1fcb:B, 1kbi:B, 1kbj:A, 1kbj:B, 3ks0:A, 3ks0:B, 1lco:A, 1lco:B, 1ldc:A, 1ltd:A, 1ltd:B, 2oz0:A, 2oz0:B, 1qcw:A, 1qcw:B, 1sze:A, 1sze:B, 1szf:A, 1szf:B, 1szg:A, 1szg:B |
15 | 1x3x:A | 82 | 66 | 0.2660 | 0.3049 | 0.3788 | 2.07e-09 | 1x3x:B |
16 | 1sox:A | 463 | 81 | 0.3298 | 0.0670 | 0.3827 | 9.97e-08 | 2a9a:A, 2a9a:B, 2a9b:A, 2a9c:A, 2a9c:B, 2a9d:A, 2a9d:B, 3hbp:A, 3hbq:A, 1sox:B |
17 | 1mj4:A | 79 | 73 | 0.2766 | 0.3291 | 0.3562 | 7.28e-07 | |
18 | 3e23:A | 198 | 64 | 0.2128 | 0.1010 | 0.3125 | 0.81 | |
19 | 8dyu:A | 2562 | 29 | 0.1170 | 0.0043 | 0.3793 | 3.3 | 8dyv:A |
20 | 1u8x:X | 436 | 63 | 0.2021 | 0.0436 | 0.3016 | 3.6 | |
21 | 8fcy:A | 2864 | 29 | 0.1170 | 0.0038 | 0.3793 | 3.7 | 8fd6:A, 8fdt:A |
22 | 8pqw:A | 2892 | 29 | 0.1170 | 0.0038 | 0.3793 | 3.8 | 8pqy:A, 8pqz:A, 8pqz:J |
23 | 5nug:A | 2920 | 29 | 0.1170 | 0.0038 | 0.3793 | 4.0 | 5nug:B |
24 | 7z8g:A | 3047 | 29 | 0.1170 | 0.0036 | 0.3793 | 4.2 | 8fdu:A, 7z8l:f |
25 | 1kwm:A | 402 | 57 | 0.2234 | 0.0522 | 0.3684 | 4.3 | 1kwm:B, 1zli:A |
26 | 8ptk:f | 4502 | 29 | 0.1170 | 0.0024 | 0.3793 | 5.3 | 8ptk:e |
27 | 7z8f:e | 4579 | 29 | 0.1170 | 0.0024 | 0.3793 | 5.7 | 5owo:A, 8pr2:f, 8ptk:m, 8ptk:n, 7z8f:f, 7z8f:m, 7z8f:n, 7z8h:A |
28 | 2d2c:D | 168 | 24 | 0.1170 | 0.0655 | 0.4583 | 6.5 | 2d2c:Q, 2e74:D, 2e75:D, 2e76:D, 4h0l:D, 4h13:D, 4i7z:D, 4pv1:D, 1vf5:D, 1vf5:Q |
29 | 3ats:A | 352 | 27 | 0.1170 | 0.0312 | 0.4074 | 6.7 | 3att:A |