BioLiP

>protein
DKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDA
YYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFP

The query sequence (length=130) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8g0h:C	227	130	1.0000	0.5727	1.0000	5.76e-93	4av1:A, 4av1:C, 4dqy:D, 4dqy:A, 4dqy:B, 4dqy:E, 8g0h:A, 2jvn:A, 3od8:A, 3od8:B, 3od8:C, 3od8:E, 3od8:G, 3od8:H, 3oda:A, 3oda:B, 3oda:C, 3oda:E, 3oda:G, 3oda:H, 4opx:D, 4opx:A, 4oqa:D, 4oqa:A, 4oqb:D, 4oqb:A, 2riq:A, 7s68:A, 7s6h:C, 7s6h:A, 7s6m:A, 7s6m:C, 7s81:I, 7s81:F, 7s81:G, 7s81:O, 7s81:J, 7s81:B
2	2w4l:C	142	49	0.1154	0.1056	0.3061	0.43
3	6hjw:B	245	46	0.0923	0.0490	0.2609	2.4	6hjw:A
4	7b1s:C	265	63	0.1385	0.0679	0.2857	4.7	7b1s:F, 7b2c:C, 7b2c:F
5	5tjg:D	1475	44	0.1231	0.0108	0.3636	6.0
6	4xln:J	1367	44	0.1231	0.0117	0.3636	6.1	3aoh:D, 3aoh:N, 3aoi:D, 3aoi:N, 6asg:D, 4gzy:D, 4gzz:D, 5i2d:D, 5i2d:O, 4mq9:D, 7rdq:D, 4wqt:D, 4wqt:I, 4wqt:N, 4xlp:J, 4xlq:J, 4xlr:J, 4xls:J
7	4yd9:A	1656	37	0.0923	0.0072	0.3243	7.3	4yd9:D, 4yd9:G, 4yd9:J, 4yd9:M, 4yd9:P, 4yd9:S, 4yd9:V, 4yd9:Y, 4yd9:b
8	2w4l:E	162	38	0.0923	0.0741	0.3158	9.7	2w4l:A, 2w4l:B, 2w4l:D, 2w4l:F
9	2buf:C	298	111	0.2308	0.1007	0.2703	9.7	2buf:A, 2buf:B, 2buf:D, 2buf:E, 2buf:F, 2buf:G, 2buf:H, 2buf:I, 2buf:J, 2buf:L

[Back]