Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
DIYIPPEGLYFRLLGFASRQVIFARNSPSPDVGLSPVNDQATDQYFSLIYGTGEHAGLYAIKSKATGKVLFSRRPAEPYV
GQIDGDGRYPDNWFKIEPGKTYLSKYFRLVQPSTGTALVSRTHLQPYFWNHPQTEVFDDQYFTFLFE

The query sequence (length=147) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 1w3a:A 312 147 1.0000 0.4712 1.0000 2.87e-108 1w3f:A, 1w3g:A, 2y9g:A
2 8b8f:A 151 148 0.5374 0.5232 0.5338 8.55e-46 8b97:A
3 4i4s:A 146 143 0.4286 0.4315 0.4406 6.64e-25 4i4s:B, 4i4s:D, 4i4u:A, 4i4u:B, 4i4u:D, 4i4x:A, 4i4x:B, 4i4x:C, 4i4x:D, 4i4y:B, 4i4y:C, 4i4y:D
4 4i4s:A 146 87 0.1565 0.1575 0.2644 0.007 4i4s:B, 4i4s:D, 4i4u:A, 4i4u:B, 4i4u:D, 4i4x:A, 4i4x:B, 4i4x:C, 4i4x:D, 4i4y:B, 4i4y:C, 4i4y:D
5 8fr7:A 1275 41 0.1020 0.0118 0.3659 3.0 8fr7:C, 8fr7:B
6 2rmp:A 358 88 0.1769 0.0726 0.2955 3.5
7 6e0w:A 602 82 0.1701 0.0415 0.3049 4.1 6e0w:B
8 2dy1:A 660 24 0.0680 0.0152 0.4167 5.6 1wdt:A
9 6oxd:A 736 51 0.0884 0.0177 0.2549 7.6 6oxc:A
10 5fqg:A 583 54 0.1156 0.0292 0.3148 7.7 5fqh:A, 5fr0:A
11 8gxv:A 353 26 0.0680 0.0283 0.3846 8.2

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218