DISTAVVVTTISDGGFLDRLAPALRDAGARLIVIPDRNTGPALFAACERHRRLGLDVVCPSVAEQQDLLERLAVPDLIPY
HSDNRRNVGYLMAWMEGFDVIVSMDDDNLPTTDDFVERHQVVCQGPRTQPVTASSDGWFNNCALLEVEPTEVFPRGFPFH
ARPAHAQARTSVCERPADVRINAGLWLGDPDVDAITRLAVRPNALAHSGGSVVLAEGTWCPVNSQNTAVHRDALPAYYFL
RMGQPVDGVPMERFGDIFSGYFVQVCAQHLGHAVRFGDPVVEHPRNEHDLLDDLHKEVPAVRLLDDILDHLRDHPLEGGD
YLETYESLSYALQEIAERVNGRAWSPDARAFLHRSAHLMRSWTGALRTVAGT
The query sequence (length=372) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7xpt:A | 375 | 370 | 0.9946 | 0.9867 | 1.0000 | 0.0 | 8hl8:A, 8hl8:C, 7xpr:A, 7xpr:B, 7xps:A, 7xps:B, 7xpt:B, 7xpu:A, 7xpu:B, 7xpv:A, 7xpv:B, 7yua:A, 7yua:B, 7yua:C, 7yua:D |
2 | 1kl7:A | 509 | 135 | 0.0995 | 0.0727 | 0.2741 | 0.13 | 1kl7:B |
3 | 3efv:A | 459 | 53 | 0.0511 | 0.0414 | 0.3585 | 1.7 | 3efv:B, 3efv:C, 3efv:D |
4 | 4n5f:A | 378 | 134 | 0.0941 | 0.0926 | 0.2612 | 2.2 | 4n5f:B |
5 | 4kg0:A | 157 | 112 | 0.0726 | 0.1720 | 0.2411 | 2.7 | |
6 | 2oua:A | 188 | 97 | 0.0618 | 0.1223 | 0.2371 | 2.7 | 2oua:B |
7 | 6pd0:A | 366 | 34 | 0.0323 | 0.0328 | 0.3529 | 7.9 | 6pcz:A, 6pcz:B, 6pd0:B |
8 | 5wti:Z | 982 | 31 | 0.0376 | 0.0143 | 0.4516 | 7.9 | |
9 | 5fob:A | 642 | 50 | 0.0403 | 0.0234 | 0.3000 | 9.6 | 7bag:A, 3g6j:A, 3g6j:C, 2ice:A, 2ice:D, 2icf:A, 5o32:A, 5o32:E, 2qki:A, 2qki:D, 2wii:A, 2xwb:A, 2xwb:C |
10 | 5zqx:A | 536 | 23 | 0.0269 | 0.0187 | 0.4348 | 9.8 | 5zqs:A, 5zqs:B, 5zqx:B, 5zqx:C, 5zqx:D |