BioLiP

>protein
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHI
RSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI

The query sequence (length=123) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4ibi:B	127	123	1.0000	0.9685	1.0000	2.71e-88	4ibb:A, 4ibb:B, 4ibc:A, 4ibc:B, 4ibd:A, 4ibd:B, 4ibe:A, 4ibe:B, 4ibf:A, 4ibf:B, 4ibg:A, 4ibg:B, 4ibi:A, 4ibj:A, 4ibj:B, 4ibk:A, 4ibk:B, 3l25:A, 3l25:B, 3l25:D, 3l25:E, 3l26:A, 3l26:B
2	3ks8:B	124	122	0.8780	0.8710	0.8852	3.44e-79	3ks8:C, 3ks8:D, 3ks8:A, 4lg2:A, 4lg2:D
3	4ghl:A	132	123	0.4309	0.4015	0.4309	5.23e-34	4gha:A, 4gha:E, 4gha:G, 4gha:C, 4ghl:D, 4ghl:B, 4ghl:C
4	6eet:A	443	41	0.1220	0.0339	0.3659	1.1	6bxz:C, 6bxz:A, 6c10:A, 5kj4:A, 5kj4:B, 5kj4:C, 5kj4:D
5	5cwa:A	505	56	0.1220	0.0297	0.2679	2.7
6	5nem:3	220	16	0.0732	0.0409	0.5625	3.5
7	7bvd:A	499	56	0.1138	0.0281	0.2500	4.1
8	4quw:A	223	49	0.1301	0.0717	0.3265	4.6	6jzu:B, 6jzy:B, 6jzz:B, 4rc5:A, 4rc5:B, 4rc6:A, 4rc6:B, 4rc7:A, 4rc7:B, 4rc8:A
9	4e2x:A	405	39	0.1057	0.0321	0.3333	6.7	4e2w:A, 4e2y:A, 4e2z:A, 4e30:A, 4e31:A, 4e32:A, 4e33:A, 3ndi:A, 3ndj:A
10	2z9v:A	392	64	0.1382	0.0434	0.2656	7.0	2z9v:B, 2z9w:A, 2z9w:B, 2z9x:A, 2z9x:B

[Back]