BioLiP

>protein
DINVVNALAYEDFVKLFGNVVEKCPLISAAIWSYRPFKDLADIEARISEFIHSLPDSGKEGILRCHPDLAGRDLQSGTLT
PESQEEQSQAGMTTLDSAEIVHMYRLNSEYKERFGFPFVICARLNNKADIVRQLSERLKNRRTAELECAIEEVKKICSLR
LHSI

The query sequence (length=164) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2o73:F	168	164	1.0000	0.9762	1.0000	3.63e-122	2o73:A, 2o73:B, 2o73:C, 2o73:D, 2o73:E, 2o74:A, 2o74:B, 2o74:C, 2o74:D, 2o74:E, 2o74:F
2	2q37:A	142	76	0.2012	0.2324	0.4342	2.45e-10
3	3o7j:A	166	160	0.2256	0.2229	0.2313	1.13e-04
4	8rqh:B	382	95	0.1463	0.0628	0.2526	0.18	8rqh:A
5	6o8w:d	201	55	0.1098	0.0896	0.3273	0.66	7nhk:e, 6o8x:d, 6o8y:d, 6o8z:d, 6o90:d, 7p7q:e, 7p7r:e, 7p7s:e, 7p7t:e, 7p7u:e, 6w6p:d, 6wub:d
6	2dq7:X	263	76	0.1280	0.0798	0.2763	1.3
7	6m9m:A	207	89	0.1220	0.0966	0.2247	3.0
8	7rk5:B	501	35	0.0793	0.0259	0.3714	3.1	7rk5:A
9	3vu1:B	490	77	0.1341	0.0449	0.2857	3.8	3vu1:A
10	4bjz:A	395	35	0.0671	0.0278	0.3143	4.3	4bjy:A, 4bk1:A, 4bk2:A, 4bk3:A, 5hym:A
11	4wjw:B	673	33	0.0854	0.0208	0.4242	4.4
12	8w2h:A	761	48	0.0732	0.0158	0.2500	4.4	7lw1:A, 7lw1:D, 7lw1:E, 7lw1:F, 8w2g:A, 8w2g:B, 8w2g:D, 8w2g:C, 8w2h:B, 8w2h:C, 8w2h:D, 8w2j:E, 8w2j:F, 8w2j:G, 8w2j:H, 8w2j:A, 8w2j:B, 8w2j:C, 8w2j:D
13	4aw2:A	398	44	0.0854	0.0352	0.3182	7.0
14	3icq:T	949	68	0.0976	0.0169	0.2353	8.2	3icq:U

[Back]