BioLiP

>protein
DILPLSPVSRNRLAQVKRKILVLDLDETLIHSHHDGPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVF
TASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPS
DTALLNLLPMLDALRFTADVRSVLSRNSAKGSESNSLEQAEDLKAFERRLTEYIHCLQAPSIIAARCRTVLAEYNMS

The query sequence (length=237) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8ujm:B	237	237	1.0000	1.0000	1.0000	1.75e-176	8ujm:A
2	2hhl:C	184	179	0.3249	0.4185	0.4302	4.37e-43	2hhl:A, 2hhl:D
3	1t9z:A	181	174	0.3376	0.4420	0.4598	2.99e-42	6du2:A, 6du2:B, 6du3:A, 6du3:B, 2ghq:A, 2ghq:B, 2ght:A, 2ght:B, 3l0b:A, 3l0c:A, 3l0c:B, 3l0y:A, 3l0y:B, 3pgl:A, 3pgl:B, 1ta0:A, 4ygy:A, 4ygy:B, 4yh1:A, 4yh1:B
4	2q5e:A	181	172	0.3080	0.4033	0.4244	7.74e-42	2q5e:B, 2q5e:C, 2q5e:D, 2q5e:E, 2q5e:F, 2q5e:G, 2q5e:H
5	4qqf:F	191	167	0.2447	0.3037	0.3473	3.84e-28	3qle:A
6	3ef1:A	372	153	0.1688	0.1075	0.2614	1.56e-05	3ef0:A, 4xpz:A, 4xq0:A
7	7y7b:L	150	62	0.0717	0.1133	0.2742	0.74	7y8a:L
8	1b0b:A	142	53	0.0549	0.0915	0.2453	1.8	1ebt:A, 1flp:A, 1moh:A
9	7rty:A	244	18	0.0422	0.0410	0.5556	4.1	7rty:B
10	5idj:A	242	24	0.0464	0.0455	0.4583	4.7	5idm:A, 5idm:B
11	4z61:A	610	45	0.0717	0.0279	0.3778	5.9	4z5w:B, 4z5w:A, 4z61:B
12	3rcd:A	281	41	0.0591	0.0498	0.3415	7.5	3rcd:C
13	5xvs:B	366	40	0.0591	0.0383	0.3500	7.9	5xvs:A, 5zlt:B, 5zlt:D
14	6z1p:By	107	45	0.0506	0.1121	0.2667	9.7

[Back]