BioLiP

>protein
DIGRSSVRPYLEECTRRFQEMFDRHVVTRPTKVELTDAELREVIDDCNAAVAPLGKTVSDERWISYVGLVLWSQSPRHIK
DMEAFKAVCVLNCVTFVWDDMDPALHDFGLFLPQLRKICEKYYGPEDAEVAYEAARAFVTSDHMFRDSPIKAALCTTSPE
QYFRFRVTDIGVDFWMKMSYPIYRHPEFTEHAKTSLAARMTTRGLTIVNDFYSYDREVSLGQITNCFRLCDVSDETAFKE
FFQARLDDMIEDIECIKAFDQLTQDVFLDLIYGNFVWTTSNKRYKT

The query sequence (length=286) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7ao3:A	303	283	0.9825	0.9274	0.9929	0.0	7ao0:A, 7ao0:B, 7ao1:A, 7ao1:B, 7ao2:A, 7ao2:B, 7ao3:B, 7ao5:A, 7ao5:B, 6ggi:A, 6ggi:B, 6ggj:A, 6ggj:B, 6ggk:A, 6ggk:B, 6ggl:A, 6ggl:B, 5gue:A, 5gue:B, 5gue:C, 5gue:D, 8qws:A, 8qws:B
2	2l51:A	102	62	0.0629	0.1765	0.2903	0.42	2l51:B
3	6vyd:A	304	148	0.1154	0.1086	0.2230	0.74	6vyd:B, 6w26:I, 6w26:A
4	4b29:A	195	93	0.0909	0.1333	0.2796	1.3
5	6djk:A	376	37	0.0455	0.0346	0.3514	1.6
6	3k2s:A	243	59	0.0559	0.0658	0.2712	1.9	6cch:A, 3k2s:B, 7rsc:D, 7rsc:E, 7rse:D, 7rse:E, 6w4e:D
7	7xwo:B	272	32	0.0455	0.0478	0.4062	2.0
8	3cke:D	284	85	0.0769	0.0775	0.2588	2.1
9	8h6u:A	338	120	0.1049	0.0888	0.2500	2.2	8h6u:B, 8h6u:C, 8h6u:D
10	3mmt:A	341	24	0.0420	0.0352	0.5000	4.5	3mmt:B, 3mmt:C, 3mmt:D
11	5yhw:A	453	50	0.0594	0.0375	0.3400	5.2	5yhw:B, 5yhw:C, 5yhw:F
12	4dz4:B	323	48	0.0594	0.0526	0.3542	8.5	4dz4:A, 4dz4:C, 4dz4:D, 4dz4:E, 4dz4:F
13	1xrs:A	516	77	0.0664	0.0368	0.2468	8.9
14	1dgp:A	290	95	0.0944	0.0931	0.2842	9.6	1dgp:B
15	4dzh:A	439	90	0.0839	0.0547	0.2667	9.9

[Back]