DHCARHGEKLLLFCQEDSKVICWLCERSQEHRGHHTFLMEEVAQEYHVKLQTALEMLRQKQQEAETERNQVAALIARGKA
LGEQTQYMRELISELEHRLQGSMMDLLQGVDGIIKRIE
The query sequence (length=118) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5eiu:A | 134 | 130 | 1.0000 | 0.8806 | 0.9077 | 4.49e-80 | 5eiu:D, 5f7t:E, 5f7t:F, 5f7t:H, 5f7t:L, 5iea:A, 5iea:B, 5iea:C, 5iea:D, 5iea:F, 5iea:K |
2 | 5va4:A | 123 | 121 | 0.8051 | 0.7724 | 0.7851 | 7.22e-64 | |
3 | 4tn3:B | 362 | 166 | 0.8559 | 0.2790 | 0.6084 | 1.46e-58 | 5k3q:A, 5k3q:B, 5k3q:C, 5k3q:D, 4tn3:A, 5w9a:A, 5w9a:B |
4 | 2yrg:A | 59 | 37 | 0.3051 | 0.6102 | 0.9730 | 1.07e-22 | |
5 | 5olm:B | 132 | 40 | 0.1610 | 0.1439 | 0.4750 | 1.82e-08 | 5jpx:A, 5olm:A |
6 | 7xyz:B | 456 | 112 | 0.2712 | 0.0702 | 0.2857 | 2.07e-07 | 7xv2:A, 7xyy:A, 7xyy:B, 7xyz:A, 7xyz:C, 7xyz:D, 7xz0:A, 7xz0:B, 7xz1:A, 7xz1:B, 7xz2:A, 7xz2:B, 7xz2:C, 7xz2:D |
7 | 7xt2:B | 388 | 111 | 0.2797 | 0.0851 | 0.2973 | 4.74e-06 | 7xt2:A |
8 | 1ser:B | 421 | 60 | 0.2203 | 0.0618 | 0.4333 | 6.55e-06 | 1ses:A, 1ses:B, 1set:A, 1set:B |
9 | 2csv:A | 72 | 34 | 0.1441 | 0.2361 | 0.5000 | 6.47e-05 | |
10 | 2did:A | 53 | 32 | 0.1271 | 0.2830 | 0.4688 | 7.37e-05 | 2dif:A |
11 | 2egm:A | 57 | 37 | 0.1186 | 0.2456 | 0.3784 | 8.20e-04 | |
12 | 1fre:A | 39 | 35 | 0.1017 | 0.3077 | 0.3429 | 0.003 | |
13 | 2dja:A | 84 | 55 | 0.1525 | 0.2143 | 0.3273 | 0.076 | |
14 | 4cg4:C | 376 | 83 | 0.1949 | 0.0612 | 0.2771 | 0.43 | 4cg4:D, 4cg4:E, 4cg4:F |
15 | 2jun:A | 101 | 34 | 0.1017 | 0.1188 | 0.3529 | 0.56 | 2dq5:A |
16 | 8jwu:C | 412 | 45 | 0.1186 | 0.0340 | 0.3111 | 2.8 | 8jwj:A, 8jwj:C, 8jws:A, 8jws:B, 8jws:C, 8jwu:A, 8jwu:B |
17 | 8pv6:Ch | 389 | 44 | 0.1271 | 0.0386 | 0.3409 | 3.2 | 8pv8:Ch |
18 | 2asb:A | 226 | 29 | 0.1017 | 0.0531 | 0.4138 | 3.5 | 2atw:A, 2atw:C |
19 | 7cpx:A | 2262 | 41 | 0.1186 | 0.0062 | 0.3415 | 3.7 | 7cpx:B, 7cpy:A, 7cpy:B |
20 | 8i9x:CJ | 494 | 50 | 0.1356 | 0.0324 | 0.3200 | 4.2 | 8i9p:CJ, 8i9r:CJ, 8i9t:CJ, 8i9v:CJ, 8i9w:CJ, 8i9y:CJ, 8i9z:CJ, 8ia0:CJ, 8pv1:CJ, 8pv2:CJ, 8pv3:CJ, 8pv4:CJ, 8pv6:CJ, 8pv7:CJ, 8pvk:CJ, 8pvl:CJ |
21 | 3pwu:A | 274 | 50 | 0.1017 | 0.0438 | 0.2400 | 4.8 | 3pwv:A, 3pwv:D |
22 | 6r1n:A | 420 | 79 | 0.1525 | 0.0429 | 0.2278 | 5.9 | |
23 | 3s27:H | 797 | 53 | 0.1356 | 0.0201 | 0.3019 | 8.8 | 3s27:A, 3s27:B, 3s27:C, 3s27:D, 3s27:E, 3s27:F, 3s27:G, 3s28:A, 3s28:B, 3s28:C, 3s28:D, 3s28:E, 3s28:F, 3s28:G, 3s28:H, 3s29:A, 3s29:B, 3s29:C, 3s29:D, 3s29:E, 3s29:F, 3s29:G, 3s29:H |